DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and ak9

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_685909.5 Gene:ak9 ZFINID:ZDB-GENE-041014-337 Length:1762 Species:Danio rerio

Alignment Length:722 Identity:132/723 (18%)
Similarity:220/723 (30%) Gaps:281/723 (39%)


  Fly    55 MQN-----AGKIKFDPPKVPVIFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQY------- 107
            :||     :.|....||.:.| .:||..||||.|| ..::.::.|:.||...:.||:.       
Zfish   797 LQNPELYISNKELLKPPALRV-SMLGVRGSGKTTH-GKWLAQQLGIFHIQFRERLQELIQRKTQK 859

  Fly   108 ---------------------------------------------------------AMGND--- 112
                                                                     |:..|   
Zfish   860 RVSPADDSEPPEEPPEELQSLLKAQARIQSAESPTDQDNTTSLEETASGSPDAKEEEALTEDEEA 924

  Fly   113 ----MQDFSQLSSKTVTEVLMLEMKMAP-AAKAYLISGYPRSMRDV-----------------VE 155
                :|:...|.|:.:..:|.......| .:..:::.|:|::..:|                 ||
Zfish   925 IKAYLQNGDPLPSEILEMLLFQWWNQEPYKSTGFILEGFPQNHEEVSFMAEHHLFPDVVAVMSVE 989

  Fly   156 YSEKIQVVNGVILISWRQSVLQKQIDYGAKLGHVVLSLAKMELENFFKNVMPVADYFDQSDMLLA 220
            .||.::.:....|..||:...:||...     |:|:.|.|...|.                   |
Zfish   990 VSEVVRRLLPSRLNRWRERRERKQQQI-----HLVMKLRKEIRER-------------------A 1030

  Fly   221 VNGERAPTEVYKDFRTAVLDILSTLENQEAVMNGVTGMG--RGIHDIPGSIVSVDTAPSQAQQGT 283
            :...||.....:.||......||.|:.||........:.  :.:.:|...:  ::..|.:.::.|
Zfish  1031 ITKRRAEIMAEQAFRKLSPPTLSPLKEQEEEEEKEEAVDEEQELEEIEAML--LEEFPPEDEEET 1093

  Fly   284 QIAEDNDVTNASE-----------------TAGTVLARDLAIERMDGGPNGAVTA---------- 321
            :..|.....:|.|                 |:.|.|..|..|.|:      .::|          
Zfish  1094 EDEEQETEESAEERLEVEISERFEKDDDNLTSMTDLLSDNQIPRL------VISAGRLPRIVRYQ 1152

  Fly   322 -LKTGTTSADDDSGVVVTQQP--------------KLRQAAG---------------PDES---- 352
             ||......::...:..|.||              |...|.|               |.:|    
Zfish  1153 LLKEIKPLMENRDSLFQTCQPISYSLARRLLYCSFKYPSAFGCWDPVKYTEGDLIQPPQDSYHST 1217

  Fly   353 ----------------------------------GSDLPPIIWVIGGPGSNKATLCLKAVGLNPG 383
                                              ...||..:.:||.|.|.|.|:. :|.....|
Zfish  1218 FPVILHQFIYFFASKETRNTFILNPIKYLRQPRPNPSLPIKLAIIGPPKSGKTTVA-QAFAREYG 1281

  Fly   384 WAHISVGRLLRNITDSAPRANTE-SFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRT-GIIVDG 446
            ...:|:|..:|.:.:|  :|.|: :..|:..|..|...|::...|.:|..:..|...| |.::||
Zfish  1282 LTRLSIGDAIRMVLNS--QAKTDLACQVQIHLKQGQTVPDELAIQCVEVAVMNLVCTTRGFVLDG 1344

  Fly   447 YPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRGRIDDTVSSFRRRLELFREQTLPMLKILDTSN 511
            :|....|.:..|:      .||.:...:|||      |||...:|.|   |::        :.:|
Zfish  1345 FPVTKHQAELLES------CIIPMVVVELQL------DTVEVLKRGL---RDR--------EKNN 1386

  Fly   512 RLQIVDGDTDSPSVQREFERLIRNHIQRLLNKTDDIDDSANLGNQMMRNEQTDAILHDLETNVPG 576
            |...|..|:                :|.|           |:.|...|.|.....|| |......
Zfish  1387 RSHQVHHDS----------------LQAL-----------NIRNSCFRQEAEALRLH-LHNQYHN 1423

  Fly   577 AVPTISH 583
            ..|..:|
Zfish  1424 WTPVDAH 1430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 43/260 (17%)
ADK 70..230 CDD:238713 41/249 (16%)
aden_kin_iso1 358..521 CDD:130427 43/165 (26%)
ADK 359..521 CDD:238713 43/164 (26%)
ak9XP_685909.5 adk 33..280 CDD:273569
ADK 33..276 CDD:238713
AAA_17 394..504 CDD:289950
DUF3508 <717..804 CDD:288841 2/7 (29%)
Ribosomal_L24e_L24 <775..808 CDD:294589 3/11 (27%)
NK 816..>983 CDD:302627 24/169 (14%)
Adk 1258..1445 CDD:223637 54/228 (24%)
ADK 1258..1432 CDD:238713 54/228 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121789080
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.