DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and CMPK1

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_057392.1 Gene:CMPK1 HGNCID:18170 Length:228 Species:Homo sapiens

Alignment Length:197 Identity:47/198 (24%)
Similarity:95/198 (48%) Gaps:28/198 (14%)


  Fly   357 PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTES---FAVKEALAAGD 418
            |.:::|:||||:.|.|.|.:.|. ..|:.|:|.|.|||:     .|.|.:|   ..:::.:..|.
Human    35 PLVVFVLGGPGAGKGTQCARIVE-KYGYTHLSAGELLRD-----ERKNPDSQYGELIEKYIKEGK 93

  Fly   419 MAPEKSLNQLLETNLRQL----RDRTGIIVDGYPRNLQQVKYFENKYKQRPP---IILLDCSK-- 474
            :.|.:....||:..:.|.    ..:...::||:|||...::.:......:..   ::..||:.  
Human    94 IVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEI 158

  Fly   475 -----LQLGR--GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERL 532
                 |:.|:  ||.||...|..:|::.:.:.|.|::.:.:...:::.:|.   |.||...|:.:
Human   159 CIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDA---SKSVDEVFDEV 220

  Fly   533 IR 534
            ::
Human   221 VQ 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 42/182 (23%)
ADK 359..521 CDD:238713 42/181 (23%)
CMPK1NP_057392.1 UMP_CMP_kin_fam 37..225 CDD:273576 46/196 (23%)
ADK 37..216 CDD:238713 45/188 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S511
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378291at2759
OrthoFinder 1 1.000 FOG0000706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.