DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and ak2

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_012812152.1 Gene:ak2 XenbaseID:XB-GENE-491598 Length:241 Species:Xenopus tropicalis

Alignment Length:231 Identity:50/232 (22%)
Similarity:88/232 (38%) Gaps:63/232 (27%)


  Fly   344 RQAAGPDESGSDLPPI-IWVIGGPGSNKAT--------LCLKAVGLNPGWAHISVGRLLRNITDS 399
            |:|| |.|.||.:..| ..::|.||:.|.|        .|:         .|::.|.:||.:..|
 Frog     4 REAA-PAERGSVMEGIRAILLGPPGAGKGTQAPKLAEKYCV---------CHLATGDMLRAMVAS 58

  Fly   400 APRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQR 464
            ....   ...:|..:.||.:..::.:.:|:|.||.....:.|.::||:||.::|.:..:...::|
 Frog    59 GSEL---GMRLKATMDAGKLVSDEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKR 120

  Fly   465 PP--------------IILLDCSKL---QLGRG-----------------------RIDDTVSSF 489
            ..              ::...|.:|   ..||.                       |.||..::.
 Frog   121 QEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTL 185

  Fly   490 RRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSV 525
            :.|||.:...|.|:::..........||. ..||.|
 Frog   186 KSRLEAYHTMTSPLVEYYQRHGIHTAVDA-AQSPDV 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 40/212 (19%)
ADK 359..521 CDD:238713 40/211 (19%)
ak2XP_012812152.1 adk 19..231 CDD:234711 42/216 (19%)
ADK 19..221 CDD:238713 42/216 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.