| Sequence 1: | NP_001260273.1 | Gene: | CG9541 / 34220 | FlyBaseID: | FBgn0032083 | Length: | 646 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012812152.1 | Gene: | ak2 / 448011 | XenbaseID: | XB-GENE-491598 | Length: | 241 | Species: | Xenopus tropicalis |
| Alignment Length: | 231 | Identity: | 50/231 - (21%) |
|---|---|---|---|
| Similarity: | 88/231 - (38%) | Gaps: | 63/231 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 344 RQAAGPDESGSDLPPI-IWVIGGPGSNKAT--------LCLKAVGLNPGWAHISVGRLLRNITDS 399
Fly 400 APRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQR 464
Fly 465 PP--------------IILLDCSKL---QLGRG-----------------------RIDDTVSSF 489
Fly 490 RRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSV 525 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9541 | NP_001260273.1 | aden_kin_iso1 | 67..238 | CDD:130427 | |
| ADK | 70..230 | CDD:238713 | |||
| aden_kin_iso1 | 358..521 | CDD:130427 | 40/211 (19%) | ||
| ADK | 359..521 | CDD:238713 | 40/210 (19%) | ||
| ak2 | XP_012812152.1 | adk | 19..231 | CDD:234711 | 42/215 (20%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||