DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and CG15543

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001287617.1 Gene:CG15543 FlyBaseID:FBgn0039799 Length:290 Species:Drosophila melanogaster

Alignment Length:173 Identity:32/174 (18%)
Similarity:63/174 (36%) Gaps:43/174 (25%)


  Fly    71 IFVLGGPGSGKVTHCDTFMQERRGVTHI-----NMM----DLLQQYAMGNDMQDF-SQLSSKTVT 125
            |.:.|.||||           ||.:.::     |::    |:|..:::....||. |:|..:.:.
  Fly    90 IVLHGKPGSG-----------RRSLAYVLAQRWNLLILDADVLAYHSINKQDQDEPSRLLQEAIE 143

  Fly   126 EVLMLEMKMA-------------PAAKAYLISGYPRSMRDVVEYSEKIQV-VNGVILIS-----W 171
            :..:.:...|             ...:.:::..||.:..:..|..|...| .|..:.:.     .
  Fly   144 KDCVYKRSQAVGNLIENRLLQEDALHRGWILINYPNNKCEAEELFEGFTVPPNRFVFLQIDERLA 208

  Fly   172 RQSVLQKQIDYGAKLGHVVLSLAKMELENFFKNVMPVADYFDQ 214
            |..:|......|.: .||  |....::..|.|:...::.|..|
  Fly   209 RMRILLNSYSPGPQ-AHV--SFVDRQMAQFRKSEPALSSYLSQ 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 32/174 (18%)
ADK 70..230 CDD:238713 32/174 (18%)
aden_kin_iso1 358..521 CDD:130427
ADK 359..521 CDD:238713
CG15543NP_001287617.1 NK 89..>213 CDD:302627 23/134 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23359
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.