DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and Dak1

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_651456.1 Gene:Dak1 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster

Alignment Length:225 Identity:52/226 (23%)
Similarity:106/226 (47%) Gaps:35/226 (15%)


  Fly   322 LKTGTTSADDDSGVVVTQQPKLRQAAGPDESGSDLPPIIWVIGGPGSNKATLCLKAVGLNPGWAH 386
            :.|.:|:...:.|::..::||                |::|:||||:.|.|.|.:.|. ...:.|
  Fly    44 ITTTSTAPPHNIGIMSVEKPK----------------IVFVLGGPGAGKGTQCSRIVD-RFQFTH 91

  Fly   387 ISVGRLLRNITDSAPRANTE-SFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRN 450
            :|.|.|||   :...|..:| ...:::.:..|.:.|.:....||| |..:...::..::||:|||
  Fly    92 LSAGDLLR---EERSREGSEFGNLIEDYIRNGKIVPVEVTCSLLE-NAMKASGKSRFLIDGFPRN 152

  Fly   451 LQQVKYFENKYKQRPP---IILLDC----------SKLQLGRGRIDDTVSSFRRRLELFREQTLP 502
            ...:..:..:..::..   ::..||          .:.|.|.||.||.:.|.::|:..:...:||
  Fly   153 QDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLP 217

  Fly   503 MLKILDTSNRLQIVDGDTDSPSVQREFERL 532
            ::|..:.:.:::.:|...|:..|..|.|::
  Fly   218 IIKFFEGAGQVKRIDASPDAEEVFGEVEKI 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/177 (24%)
ADK 359..521 CDD:238713 43/176 (24%)
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 47/189 (25%)
ADK 65..240 CDD:238713 44/180 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121748492
eggNOG 1 0.900 E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S511
OrthoDB 1 1.010 D1378291at2759
OrthoFinder 1 1.000 FOG0000706
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23359
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.