DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and cmpk

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_998274.2 Gene:cmpk / 406383 ZFINID:ZDB-GENE-040426-2113 Length:219 Species:Danio rerio


Alignment Length:212 Identity:54/212 - (25%)
Similarity:103/212 - (48%) Gaps:41/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLL---RNITDSAPRANTESFAVKEALAAGD 418
            |.:::|:||||:.|.|.|.:.|. |..:.|:|.|.||   |:.|||......:|: :||    |.
Zfish    26 PQVVFVLGGPGAGKGTQCARIVE-NYSYTHLSAGDLLREERSRTDSEFGQLIDSY-IKE----GK 84

  Fly   419 MAP--------EKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPP---IILLDC 472
            :.|        .|::.:.::.:.::.|    .::||:|||...::.:..:...:..   ::..||
Zfish    85 IVPVQITINLLRKAMEETMKADEKKFR----FLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDC 145

  Fly   473 SK-------LQLGR--GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQRE 528
            |.       |:.|:  ||.||...|..:|::.:.:.|.|::::.:...::|.:|.   |.||...
Zfish   146 SNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDA---SRSVDEV 207

  Fly   529 FERLIRNHIQRLLNKTD 545
            |.     .::.:|.|.|
Zfish   208 FA-----DVKNILEKDD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 46/185 (25%)
ADK 359..521 CDD:238713 46/184 (25%)
cmpkNP_998274.2 UMP_CMP_kin_fam 28..215 CDD:273576 50/204 (25%)
ADK 28..207 CDD:238713 49/191 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.