DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and ak7a

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001166036.1 Gene:ak7a ZFINID:ZDB-GENE-040724-122 Length:696 Species:Danio rerio

Alignment Length:442 Identity:91/443 (21%)
Similarity:155/443 (35%) Gaps:130/443 (29%)


  Fly   204 NVMPVADYFDQSDMLLAVNGERAPTEVYKDFRTAVLDILSTLENQEAVMNGVTGMGRGIHDIPGS 268
            |.:|.....|.:.::..:...:..|..:    .||.|..||.|                 ||..:
Zfish   239 NNIPAVHVHDLARVVQKIIDHKPKTHYF----IAVDDSKSTFE-----------------DIVKA 282

  Fly   269 IVSVDTAPSQAQQGTQIAEDNDVTNASETAGTVLARDLAIERMDGGPNGAVTALKTGTTSADDDS 333
            |.|. ..|.|.:   ::.:::...|.:||....|:.:|.||        :|...:....:.|.:|
Zfish   283 IASA-VGPGQTE---KVLKEDASGNITETELLYLSVNLRIE--------SVFIKERLNINLDFES 335

  Fly   334 GVV-----VTQQPKLRQAAGPDESGSDLPPIIWVIGGPGSNKAT----LCLKAVGLNPGWAHISV 389
            |:|     |.::.|        ::...||..|.::|.|...|:|    || |...||......:|
Zfish   336 GIVDNIVRVVEEFK--------QTRKLLPIKICLLGPPAVGKSTVAEELC-KYYKLNHVTVDEAV 391

  Fly   390 GRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDR--------------- 439
            ...:|.:.:...| |.::...:|.|:|.:...:...|.:|: |..||.::               
Zfish   392 SEKIRQLEELLER-NEKTAENEELLSAAEEKLKAIKNSMLQ-NGGQLDNQQIIHIIMEKLNSMPC 454

  Fly   440 --TGIIVDGYPRNLQQV--------------KYFENKY-KQRPP--IILLDCSKLQLGRGRIDD- 484
              .|.::||||:...|.              :..|.|| |...|  :..||.:...| :.|:.. 
Zfish   455 RNQGFVLDGYPKTYSQANELFQDENMEVEDGRATEPKYNKVMIPEFVFSLDATDDFL-KARVRSL 518

  Fly   485 ----------TVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSV-------------- 525
                      |...|...|..||:.......:||..:.|:|.....|..:|              
Zfish   519 PQNVAEMKHYTQEEFTDSLAKFRQTLAEDESVLDYFDELEIHPEHIDCENVAVVEKIIKTVGRPM 583

  Fly   526 --------------QREFER---LIRNHIQRLLNKTDDIDDSANLGNQMMRN 560
                          ::|.||   |.:...:..|.:|.:.|..|:|..:..||
Zfish   584 NYGLSPEEMEEEKKRKEHERHQQLKQEEAENKLRETMENDKFASLLEEWNRN 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 5/34 (15%)
ADK 70..230 CDD:238713 4/26 (15%)
aden_kin_iso1 358..521 CDD:130427 46/212 (22%)
ADK 359..521 CDD:238713 46/211 (22%)
ak7aNP_001166036.1 NADB_Rossmann <162..288 CDD:304358 14/71 (20%)
WcaG <208..288 CDD:223528 14/71 (20%)
ADK 358..568 CDD:238713 47/214 (22%)
Dpy-30 653..694 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121720234
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.