DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and ak8

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_989104.1 Gene:ak8 XenbaseID:XB-GENE-5831327 Length:485 Species:Xenopus tropicalis

Alignment Length:533 Identity:103/534 (19%)
Similarity:179/534 (34%) Gaps:178/534 (33%)


  Fly    60 KIKFDPPK----------------VPVIFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLL---- 104
            |:..|.||                ||.:|:||.|.|||.|.. ..:.:|...||:....:|    
 Frog    33 KVLVDRPKDPIQYMIDHLSNDNDDVPRVFILGPPASGKHTMA-KLLCKRLNATHLTPESVLSSDV 96

  Fly   105 -------QQYA-MGNDMQDFSQLSSKTVTEVLMLEMKMAPAAKAYLISGYPRSMRDVVEYSEKIQ 161
                   |.|. .|.::.|  :|.:|.:.:.|   .|:....:.:::.|:|::            
 Frog    97 SLLAKEAQSYRDKGQEVPD--ELWAKLMQQRL---SKVDCIKRGWILEGFPKT------------ 144

  Fly   162 VVNGVILISWRQSVLQKQIDYGAKLGHVVLSLAKMELENFFKNVMPVADYFDQSDMLLAVN--GE 224
                      |:..|:.|: .|....|:|:                    .|..|::|...  |:
 Frog   145 ----------REQALKLQM-AGICPDHLVV--------------------LDAPDIVLIERNMGK 178

  Fly   225 RAPT---EVYKDFRTAVLD------ILSTLENQEAVMNGVTGMGRGI---HDIPGSIVSVDTAPS 277
            |..|   |||.    ...|      :...|...|.:....||: |.|   .:|||.:   .|.|.
 Frog   179 RIDTANGEVYH----TTFDWPSDPTVQRNLVEPEGISEEETGL-RLIEYHRNIPGIL---RTYPK 235

  Fly   278 QAQQGTQIAEDNDVTNASETAGTVLARDLAIERMDGGPNGAVTALKTGTTSADDDSGVVVTQQPK 342
            .:::          .||.:....|.::.|..                            |..:|:
 Frog   236 TSKK----------INADQPYMDVFSQVLTF----------------------------VLSKPR 262

  Fly   343 LRQAAGPDESGSDLPPIIWVIGGPGSNK---ATLCLKAVGLNPGWAHISVGRLLRN-ITDSAPRA 403
                     |.:...|.|.:.|.|||.:   |:|..:..|:    .:|..|::|:. :.|.....
 Frog   263 ---------SLAPHTPRILLYGPPGSGRSLQASLLAQKYGI----VNICCGQVLKEAVADQTKLG 314

  Fly   404 NTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRT-GIIVDGYPRNLQQVKYFENKYKQRPPI 467
            .    .::..:......|:..:.::|..:|..|...| |.::.|:||:..|....::.......:
 Frog   315 E----VIQPYIENDQQVPDNLVLKILTEHLSSLESATHGWVLHGFPRDTDQAALLKDAGFVPNRV 375

  Fly   468 ILLDCSKLQLGRGRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERL 532
            ..||.|         ||.|.   .||.|.  .|.|:     :..|...:.....|..|....::.
 Frog   376 FSLDLS---------DDVVI---ERLSLC--MTDPV-----SGERYHDIYKPAPSSEVHERLQQN 421

  Fly   533 IRNHIQRLLNKTD 545
            .|:..||:..:.|
 Frog   422 PRHSEQRVQARLD 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 40/204 (20%)
ADK 70..230 CDD:238713 35/177 (20%)
aden_kin_iso1 358..521 CDD:130427 35/168 (21%)
ADK 359..521 CDD:238713 34/167 (20%)
ak8NP_989104.1 Adenylate kinase 1. {ECO:0000250|UniProtKB:Q96MA6} 58..258 55/295 (19%)
ADK 59..249 CDD:238713 51/257 (20%)
NMPbind 1. {ECO:0000250|UniProtKB:P69441} 87..113 4/26 (15%)
LID 1. {ECO:0000250|UniProtKB:P69441} 177..206 8/33 (24%)
Adenylate kinase 2. {ECO:0000250|UniProtKB:Q96MA6} 269..472 41/194 (21%)
ADK 270..462 CDD:238713 40/193 (21%)
NMPbind 2. {ECO:0000250|UniProtKB:P69441} 298..327 3/33 (9%)
LID 2. {ECO:0000250|UniProtKB:P69441} 391..424 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121650603
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.