DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and Adk2

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_523836.2 Gene:Adk2 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster

Alignment Length:200 Identity:41/200 (21%)
Similarity:72/200 (36%) Gaps:78/200 (39%)


  Fly   362 VIGGPGSNKAT--------LCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGD 418
            ::|.|||.|.|        .|:         .|:|.|.:||....|..:...|   :|:.:.||.
  Fly    23 LLGPPGSGKGTQAPLLKEKFCV---------CHLSTGDMLRAEISSGSKLGAE---LKKVMDAGK 75

  Fly   419 MAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQL------ 477
            :..:..:..::::||.:...:.|.::||:||.:.|.:..:.         |||..|..|      
  Fly    76 LVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDT---------LLDKRKTNLDAVIEF 131

  Fly   478 --------------------GRG-----------------------RIDDTVSSFRRRLELFREQ 499
                                ||.                       |.||...:.::|||.:.:|
  Fly   132 AIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQ 196

  Fly   500 TLPML 504
            |.|::
  Fly   197 TKPLV 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 41/200 (21%)
ADK 359..521 CDD:238713 41/200 (21%)
Adk2NP_523836.2 adk 20..233 CDD:234711 41/200 (21%)
ADK 20..222 CDD:238713 41/200 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121684030
eggNOG 1 0.900 E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23359
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.