DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and Cmpk1

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001020826.1 Gene:Cmpk1 RGDID:1310116 Length:227 Species:Rattus norvegicus

Alignment Length:192 Identity:48/193 (25%)
Similarity:91/193 (47%) Gaps:28/193 (15%)


  Fly   357 PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTES---FAVKEALAAGD 418
            |.:::|:||||:.|.|.|.:.|. ..|:.|:|.|.|||:     .|.|.:|   ..:::.:..|.
  Rat    34 PLVVFVLGGPGAGKGTQCARIVE-KYGYTHLSAGELLRD-----ERKNPDSQYGELIEKYIKEGK 92

  Fly   419 MAPEKSLNQLLETNLRQL----RDRTGIIVDGYPRNLQQVKYFENKYKQRPP---IILLDCSK-- 474
            :.|.:....||:..:.|.    ..:...::||:|||...::.:......:..   ::..||:.  
  Rat    93 IVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEI 157

  Fly   475 -----LQLGR--GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREF 529
                 |:.|:  ||.||...|..:|::.:.|.|.|::.:.:...:::.:|.   |.||...|
  Rat   158 CIDRCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDA---SKSVDEVF 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/182 (24%)
ADK 359..521 CDD:238713 43/181 (24%)
Cmpk1NP_001020826.1 UMP_CMP_kin_fam 36..224 CDD:273576 47/191 (25%)
ADK 36..215 CDD:238713 46/188 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378291at2759
OrthoFinder 1 1.000 FOG0000706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.