DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and Ak9

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_008771242.1 Gene:Ak9 RGDID:1559879 Length:1888 Species:Rattus norvegicus

Alignment Length:606 Identity:119/607 (20%)
Similarity:205/607 (34%) Gaps:189/607 (31%)


  Fly    64 DPPKVPV--IFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQYAM-------GNDMQDFSQ- 118
            :|.|.|.  |.:||..|||| |.|...:.|..|:.||...:.||:..:       |.:.:|.|: 
  Rat   963 EPLKAPPLRICLLGPHGSGK-TVCARKLAENFGIFHIQFEEFLQERMLLKAERKFGPEFEDDSEE 1026

  Fly   119 ----------------------LSSKTVTEVLMLE----------------------------MK 133
                                  .:.|.:.||...|                            :|
  Rat  1027 EQAMKQELEELAAQANVKIEEDNTKKQLPEVQFTEEEEAIKLSLTDNEPLPSEILDPMLSEWWLK 1091

  Fly   134 MAPAAKAYLISGYPRSMRDVVEYSEKIQVV-------NGVILI-----------------SWRQS 174
            ....:..:::.|:||       |.|:.|.:       :..::|                 .|:..
  Rat  1092 EPIRSTGFILDGFPR-------YPEEAQFLGERGFFPDAAVIIQVDDQDIFDRLLPAQVQKWKTK 1149

  Fly   175 VLQKQ------IDYGAKLGHVVLSLAKMEL-------------------------------ENFF 202
            .|:|.      .:..||:...:::..:.||                               ||..
  Rat  1150 QLKKSERKKMIKEMKAKIKEDMVAKRRAELISEREKRKKGEGAFRDEEEFSDEDAEDEDDIENIL 1214

  Fly   203 KNVMPVADYFDQSDMLLAVNG---ERAPTEVYKDFRTAVLDILSTLENQEAVM------NGVTGM 258
            :...| .|..:.|:......|   ||..:|:.:.|.|...:|.|..:..|..:      ||    
  Rat  1215 EEEFP-KDEEEMSEEDEEQEGDATERLRSELGEKFETETNNIQSIQDEFERFLIPIIPVNG---- 1274

  Fly   259 GRGIHDIPGSIVSVDTAPSQAQQGTQIAEDNDVTNASETAGTVLARDLAIERMDGGPNGAVTALK 323
            .|.:| |...:::|...|....:.:...:...|  :...|..:||  ...:.|..........|.
  Rat  1275 ARKMH-IVQYVLNVKLKPLVENRASIFEKCYPV--SPHLAHKMLA--FTYKHMSSFGYWDPVKLS 1334

  Fly   324 TGTT-----SADDDSGVVV---------TQQPKLRQAAGP------DESGSDLPPIIWVIGGPGS 368
            .|.|     :|::....::         |:|.|.:....|      .:..:.:|..|.::|.|.|
  Rat  1335 EGETIKPVETAENPLNPIIHRHYIYFLSTKQTKEKFMMNPIKYIRQPKPKASMPVRIMIVGPPKS 1399

  Fly   369 NKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLETN- 432
            .|:|:. |.:..:.|...:|:|..||.:..:.|.|.. |..:...|..|...|:....|.|:.: 
  Rat  1400 GKSTVA-KQLANDYGLKCLSMGDALRGMLSNHPEAEL-SLRINWHLHKGMTVPDDLAIQALDISL 1462

  Fly   433 LRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIIL-LDCSKLQLGRGRIDDTVSSFRR-RLEL 495
            |..:.:..|:::||||....||:..|.: ...|.||. ||....::           |:| .||.
  Rat  1463 LDSVCNTVGVVIDGYPVTPHQVELLEAR-SIIPMIIFELDVPSKEI-----------FKRLLLEK 1515

  Fly   496 FREQTLPMLKILDTSNRLQIV 516
            ..||.:|    ....|..||:
  Rat  1516 KSEQGMP----YPMHNSTQII 1532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 50/295 (17%)
ADK 70..230 CDD:238713 46/284 (16%)
aden_kin_iso1 358..521 CDD:130427 44/163 (27%)
ADK 359..521 CDD:238713 44/162 (27%)
Ak9XP_008771242.1 adk 33..285 CDD:273569
ADK 33..276 CDD:238713
AAA 393..>422 CDD:214640
AAA_17 393..>421 CDD:289950
Ribosomal_L24e_L24 <929..965 CDD:294589 1/2 (50%)
ADK 971..>1139 CDD:238713 30/176 (17%)
PRK14527 1386..1579 CDD:237745 45/166 (27%)
ADK 1390..1562 CDD:238713 44/162 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121794207
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.