DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and AK5

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_777283.1 Gene:AK5 HGNCID:365 Length:562 Species:Homo sapiens

Alignment Length:495 Identity:121/496 (24%)
Similarity:204/496 (41%) Gaps:113/496 (23%)


  Fly    63 FDP--PKVPVIFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQYAMGNDMQDFSQLSSKTVT 125
            |||  |:..:|.|:|||||||.|. ...:.||.|..:|::.:||::............|.:|.:|
Human   125 FDPTRPRPKIILVIGGPGSGKGTQ-SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIIT 188

  Fly   126 -------EVLMLEMK----MAPAAKAYLISGYPRSMRDVVEYSEKIQVVNGVILIS-----WRQS 174
                   |..:.|:|    ..|..:..:|.|:||.:...:.:.::|...:.|:.::     .::.
Human   189 TGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKER 253

  Fly   175 VLQKQIDYGAKLGHVVLSLAKMELENFFKNVMPVADYFDQSDMLLAVNGERAPTEVYKDFRTAVL 239
            :|::....|....:|  ...:..|.||.:|..|:..||.:..:::..:.:|...||:.|...||.
Human   254 LLKRAEQQGRPDDNV--KATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD 316

  Fly   240 DILSTLENQEAVMNGVTGMGRGIHDIPGSIV-----SVDTAPSQAQQGTQIAEDNDVTNASETAG 299
            :.|  ..|:||        ..|..|:..|::     .:||......||                 
Human   317 NKL--FPNKEA--------AAGSSDLDPSMILDTGEIIDTGSDYEDQG----------------- 354

  Fly   300 TVLARDLAIERMDGGPNGAVTALKTGTTSADDDSGVVVTQQPKLRQAAGPDESG---SDLP--PI 359
                                          ||...|.           |.|..|   .||.  .|
Human   355 ------------------------------DDQLNVF-----------GEDTMGGFMEDLRKCKI 378

  Fly   360 IWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKS 424
            |::||||||.|.|.|.|.|. ..|:.|:|.|.|||   :.....:..|..:::.:..||:.|...
Human   379 IFIIGGPGSGKGTQCEKLVE-KYGFTHLSTGELLR---EELASESERSKLIRDIMERGDLVPSGI 439

  Fly   425 LNQLL-ETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSK-------LQLGRGR 481
            :.:|| |..:..|.|..|.::|||||.::|.:.|..:......:|.:|||.       ||..|..
Human   440 VLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSS 504

  Fly   482 --IDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGD 519
              :|||..:..:|||.:...::|::...:|..:|..::.:
Human   505 LPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAE 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 44/187 (24%)
ADK 70..230 CDD:238713 41/176 (23%)
aden_kin_iso1 358..521 CDD:130427 53/173 (31%)
ADK 359..521 CDD:238713 53/172 (31%)
AK5NP_777283.1 aden_kin_iso1 133..316 CDD:130427 45/186 (24%)
Adenylate kinase 1. {ECO:0000305|PubMed:19647735} 133..316 45/186 (24%)
ADK 134..307 CDD:238713 41/176 (23%)
NMPbind 1. {ECO:0000250|UniProtKB:P00568} 162..193 5/31 (16%)
LID 1. {ECO:0000250|UniProtKB:P00568} 256..266 1/10 (10%)
aden_kin_iso1 374..561 CDD:130427 53/176 (30%)
Adenylate kinase 2. {ECO:0000305|PubMed:19647735} 377..559 53/173 (31%)
ADK 378..550 CDD:238713 53/172 (31%)
NMPbind 2. {ECO:0000269|Ref.8} 406..435 8/32 (25%)
LID 2. {ECO:0000269|Ref.8} 499..509 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121819490
eggNOG 1 0.900 E1_COG0563
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4621
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.