DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and AK9

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_011533852.1 Gene:AK9 HGNCID:33814 Length:1988 Species:Homo sapiens

Alignment Length:642 Identity:117/643 (18%)
Similarity:206/643 (32%) Gaps:255/643 (40%)


  Fly    64 DPPKVPV--IFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQYAM-------GNDMQDFS-- 117
            :|.|.|.  |.::|..|||| |.|...:.|:..:.||...::||:..:       |.:.::.|  
Human  1057 EPLKAPPLRICLVGPQGSGK-TMCGRQLAEKLNIFHIQFEEVLQEKLLLKTEKKVGPEFEEDSEN 1120

  Fly   118 -------------------------------QLSSK----------------TVTEVLMLE--MK 133
                                           ||:.:                .:.||::.|  :|
Human  1121 EQAAKQELEELAIQANVKVEEENTKKQLPEVQLTEEEEVIKSSLMENEPLPPEILEVILSEWWLK 1185

  Fly   134 MAPAAKAYLISGYPRSMRDVVEYSEKIQVV-------NGVILI-----------------SW--- 171
            ....:..:::.|:||       |.|:.|.:       :..:.|                 .|   
Human  1186 EPIRSTGFILDGFPR-------YPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPAQIEKWKLK 1243

  Fly   172 -RQSVLQKQI--DYGAKL---------GHVVLSLAKM----------------------ELENFF 202
             ::.:.:|::  |..||:         ..::|...|.                      ::||..
Human  1244 QKKKLERKKLIKDMKAKIRVDTIAKRRAELILERDKKRRENVVRDDEEISEEELEEDNDDIENIL 1308

  Fly   203 KNVMP--------VADYFDQSDMLLAVNGE-----RAPTE----VYKDFRTAVLDILS------- 243
            ::..|        ..|...::|.:..:.||     .|.|.    :..:....::.|:|       
Human  1309 EDEFPKDEEEMSGEEDEEQETDAIERLRGELGEKFEADTHNLQIIQDELERYLIPIISINGARRN 1373

  Fly   244 -------------TLENQEAVMNGVTGMGRGIHDIPGSIVSVDTA-------------PSQAQQG 282
                         .:||:.::.       ...|.||..:......             |.:..:|
Human  1374 HIVQYTLNMKLKPLVENRASIF-------EKCHPIPAPLAQKMLTFTYKYISSFGYWDPVKLSEG 1431

  Fly   283 TQIAEDNDVTNASETAGTVLARDLAI--------ERMDGGPNGAVTALKTGTTSADDDSGVVVTQ 339
            ..|   ..|.||......|:.|....        |:....|                   :...:
Human  1432 ETI---KPVENAENPIYPVIHRQYIYFLSSKETKEKFMKNP-------------------IKYIR 1474

  Fly   340 QPKLRQAAGPDESGSDLPPIIWVIGGPGSNKAT-LCL---KAVGLNPGWAHISVGRLLRNITDSA 400
            |||.:..         :|..|.::|.|.|.|.| ||.   |.:....|..|:|:|..||.:.::.
Human  1475 QPKPKPT---------VPIRIIIVGPPKSGKTTVLCFSVAKKITSEYGLKHLSIGGALRYVLNNH 1530

  Fly   401 PRANTE-SFAVKEALAAGDMAPEKSLNQLLETNLRQ-LRDRTGIIVDGYPRNLQQVKYFENKYKQ 463
            |  .|| :..:...|..|..||::...|.||.:|.: :.:..|:::||||....|:...|  .:.
Human  1531 P--ETELALMLNWHLHKGMTAPDELAIQALELSLMESVCNTAGVVIDGYPVTKHQMNLLE--ARS 1591

  Fly   464 RPPIILLDCSKLQLGRGRIDDTVSS---FRR-RLELFREQTLPMLKILDTSNRLQIV 516
            ..|:::.:.|            |.|   |:| .||...||.||    ....|..|||
Human  1592 IIPMVIFELS------------VPSKEIFKRLLLEKENEQRLP----YPLHNSAQIV 1632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 46/309 (15%)
ADK 70..230 CDD:238713 44/298 (15%)
aden_kin_iso1 358..521 CDD:130427 49/170 (29%)
ADK 359..521 CDD:238713 49/169 (29%)
AK9XP_011533852.1 ADK 105..348 CDD:238713
Ribosomal_L24e_L24 1017..1059 CDD:321242 1/2 (50%)
ADK 1065..>1233 CDD:238713 28/176 (16%)
ADK 1485..>1612 CDD:238713 39/143 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121794035
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.