DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and F40F8.1

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001300543.1 Gene:F40F8.1 WormBaseID:WBGene00009575 Length:228 Species:Caenorhabditis elegans

Alignment Length:190 Identity:52/191 (27%)
Similarity:95/191 (50%) Gaps:15/191 (8%)


  Fly   354 SDLPPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEA-LAAG 417
            :|:..:::|:|.|||.|.|:|.| :..|..:.|:|.|.|||   ....|..:|..|:.|: :..|
 Worm    36 NDMHNVVFVLGPPGSGKGTICAK-IQENLNYVHLSAGDLLR---AERQREGSEFGALIESHIKNG 96

  Fly   418 DMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPP---IILLDCSK----- 474
            .:.|.:....|||..::...|..|.:|||:|||...::.:..:...:..   ::.|.|..     
 Worm    97 SIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIE 161

  Fly   475 --LQLGRGRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERL 532
              |..|:||.||...|.::|:|.:.:||.|:::..:.|..::.|..:.....|..:.|::
 Worm   162 RCLNRGQGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKV 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 49/174 (28%)
ADK 359..521 CDD:238713 49/173 (28%)
F40F8.1NP_001300543.1 UMP_CMP_kin_fam 41..223 CDD:273576 51/186 (27%)
ADK 41..214 CDD:238713 49/177 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378291at2759
OrthoFinder 1 1.000 FOG0000706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.