DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and ZK673.2

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_496245.1 Gene:ZK673.2 / 174608 WormBaseID:WBGene00014058 Length:222 Species:Caenorhabditis elegans


Alignment Length:211 Identity:47/211 - (22%)
Similarity:80/211 - (37%) Gaps:43/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 GGPGSNKATLCLKAV-GLNP-GWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLN 426
            |..||.|.|:....| ...| |:.:.:.|..:|   |...|........:..|..|:..|:..||
 Worm     8 GAAGSGKGTIARMLVREFEPLGFNYFAAGDFIR---DHIARGTEFGVRAQSFLNKGEHVPDSILN 69

  Fly   427 QLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYK-------QRPPIILLDCSKLQL-----GR 479
            ..:...:.:...|  :::||||||:.|:|..|.:..       :.|..:|:|....||     ||
 Worm    70 GAILAEMLKAGPR--VVLDGYPRNMSQLKMVEEQAPLNLIVELKVPRKVLIDRLSKQLVHPASGR 132

  Fly   480 G-----------------------RIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTD 521
            .                       |..|.:...|||||::.:....:|......|:...:.|:: 
 Worm   133 AYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVLDYYKKQNKCITMSGES- 196

  Fly   522 SPSVQREFERLIRNHI 537
            |.:|......::|..:
 Worm   197 SKAVFESVAEVMRRDL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 44/193 (23%)
ZK673.2NP_496245.1 Adk 3..208 CDD:440329 46/205 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.