DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and LOC108350550

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_017447812.1 Gene:LOC108350550 RGDID:11499875 Length:79 Species:Rattus norvegicus

Alignment Length:108 Identity:30/109 (28%)
Similarity:46/109 (42%) Gaps:41/109 (38%)


  Fly    60 KIKFDPPKVPVIFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQYAMGNDMQDFSQLSSKTV 124
            |:|    |..:|||:|||||||.|.|:..:| :.|.||::..|||                    
  Rat     4 KLK----KAKIIFVVGGPGSGKGTQCEKIVQ-KYGYTHLSTGDLL-------------------- 43

  Fly   125 TEVLMLEMKMAPAAKAYLISGYPRS--MRDVVEYSEKIQVVNG 165
                          :|.:.||..|.  :..::|..|.:.:|:|
  Rat    44 --------------RAEVSSGSSRGKMLSSIMEKGELVPLVSG 72

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 28/102 (27%)
ADK 70..230 CDD:238713 27/99 (27%)
aden_kin_iso1 358..521 CDD:130427
ADK 359..521 CDD:238713
LOC108350550XP_017447812.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.