DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and ak4

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_002931643.1 Gene:ak4 XenbaseID:XB-GENE-959954 Length:231 Species:Xenopus tropicalis

Alignment Length:242 Identity:59/243 (24%)
Similarity:94/243 (39%) Gaps:69/243 (28%)


  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLR-NITDSAPRANTE-SFAVKEALAAGDMAPEKS 424
            ::|.|||.|.|:| :.:..|.|..|:|.|..|| ||     ||:|| ....|:.|..|...|:..
 Frog    10 ILGPPGSGKGTVC-QRIAKNFGLQHLSSGDFLRQNI-----RASTEVGVMAKKYLEQGLPVPDSL 68

  Fly   425 LNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRGRIDDTVSSF 489
            :.:::...|..::.:..:: ||:||.|.|.:..:                      :|.|     
 Frog    69 ITRVMLFELETMKTQPWLL-DGFPRTLAQAEALD----------------------KICD----- 105

  Fly   490 RRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPS---VQREFERLIRNHIQRLLNKTDDIDDSA 551
               |:|.....:|...:.|..|...|     ..||   ...||.   ..|:|.:    |||.   
 Frog   106 ---LDLVISLNIPFETLKDRLNTRWI-----HQPSGRVYNLEFN---PPHVQGI----DDIS--- 152

  Fly   552 NLGNQMMRNE--QTDAILHDLETNVPGAVPTISHHVSMMNGHLKNRG 596
              |..:::.|  :.||::..|......|.|.|..:        ||:|
 Frog   153 --GEPLIQQEHDKPDAVISRLRQYKDVAKPVIELY--------KNKG 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 39/161 (24%)
ADK 359..521 CDD:238713 39/161 (24%)
ak4XP_002931643.1 adk 7..211 CDD:273569 59/243 (24%)
ADK 7..199 CDD:238713 59/243 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121849820
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.