DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and ak9

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_017949804.1 Gene:ak9 XenbaseID:XB-GENE-994660 Length:1821 Species:Xenopus tropicalis

Alignment Length:808 Identity:150/809 (19%)
Similarity:248/809 (31%) Gaps:299/809 (37%)


  Fly    61 IKFDPPKVPVIFVL--GGPGSGKVTHCDTFMQERRGVTHINMMDLLQ-------------QYA-- 108
            |..:|.|.|.:.||  |..|:|| |.|..::.|:.|:.||...:.||             |||  
 Frog   895 INKEPLKAPPLRVLLIGNSGAGK-TVCARWLAEKLGIFHIQFREYLQEIMLSKLQRKIGPQYAEE 958

  Fly   109 -----------MGNDMQDFSQLSSKTVTEVLMLEMKMAPAAKAYL-------------------- 142
                       |..:..|.:.....|..|.::|..: ..|.|:||                    
 Frog   959 VKEYPNEETPLMELENSDLAIAEENTAEEEVVLTDE-EEAVKSYLEDASPLPAELLDQIVTDWWS 1022

  Fly   143 ----------ISGYPRSMRDVVEYSEK---------IQVVNGVI--------LISWRQ------- 173
                      :.|:|.:..:.....||         :.|....|        |..|::       
 Frog  1023 EEPFRSTGFILDGFPNTAEETQYLGEKGFFPDIAVFLDVEESAICDRLLPPRLAKWKERQMRKEE 1087

  Fly   174 -----SVLQKQI--DYGAK-LGHVVLSLAKM-------------------------ELENFFKNV 205
                 ..|:|||  |..|| ...::....||                         ::|......
 Frog  1088 RKQKLKALKKQIRDDQIAKRRAELMAEQNKMKEEKENQKNPDEQEEEEEEEDDEGDDIELILSEE 1152

  Fly   206 MPVAD---------YFDQSDMLLAVNGERAPTEVYKDFRTAVLDILSTLENQEAVMNGVTGMGRG 261
            .|..:         .:|..:.:.:..||:...|.  :....|.|.|..|:.....:||    ||.
 Frog  1153 FPDEEEDDEEEEESEYDAVERMKSEIGEKCEAEA--ESLETVKDELQRLKIPVVTING----GRK 1211

  Fly   262 IHDIPGSIVS-----VDTAPSQAQQG--TQIAEDNDVTNASETAGTVLARDLAIERMDGGPNGAV 319
            .|.:...:..     |:...|..::.  ..:|..|.:...|....:|..|...::...|      
 Frog  1212 RHIVHYQLYEKLRNLVENRESLFEKSYPISLAVANKMLQMSYKQPSVFGRWDPVKLSQG------ 1270

  Fly   320 TALKTGTT-----------------SADDDSGVVVTQQPKLRQAAGPDESGSDLPPIIWVIGGPG 367
            ..:|...|                 |..::..:.:....|..|.|.|..|   :|..|.|:|.|.
 Frog  1271 EVIKPFFTQENPGFPLLYRQYIYFFSTKENRNLFMKNPIKYIQQAKPKPS---VPIRIAVVGPPK 1332

  Fly   368 SNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTE-SFAVKEALAAGDMAPEKSLNQLLET 431
            |.|.::......|. |...:|:|..:|::.::.|  ||| :..:...|..|.:.|:....:.||.
 Frog  1333 SGKTSVAKMFTSLY-GLKRLSIGDAIRSVLENQP--NTELATELNSILRKGLVLPDDLSVKCLEV 1394

  Fly   432 NLRQLRDRT-GIIVDGYPRNLQQV-----------KYFE---------------NKYKQRP-PI- 467
            .|..|...| |::.||:|....||           |.||               .|...|| |: 
 Frog  1395 ALMDLTSNTNGVVFDGFPVTKHQVDLLEACSIIPIKIFELQAPIKEVLKRGLEDKKNSNRPYPVH 1459

  Fly   468 ----ILL---DC------------SKLQLG-----------------RGRIDDTVSSFRRRLELF 496
                ||:   .|            |||...                 .|.:..:::..:..||..
 Frog  1460 DSAQILVVRNSCYKQEVILTKEHYSKLHQNWCEVDSLRSKWWVSNKITGEVQKSINQIQSYLERI 1524

  Fly   497 RE------------------------QTLPMLKILDTSNRLQIVDGDTDSPSVQREFERLIRNHI 537
            :|                        |..|:.    .:.|.::|| .:.:||:|  |....|.|.
 Frog  1525 KEGMAAGIADFCITPQELVSRLGEFGQYCPVC----LAQRGELVD-CSGNPSLQ--FAAEFRGHY 1582

  Fly   538 QRLLNKTDDIDDSANLGNQMMRNEQTDAILHDLETNVPGAVP-------------TISHHVSMMN 589
            .:                 |...::.||.|...|..||...|             |::...:...
 Frog  1583 YK-----------------MASQKELDAFLKSPELYVPPLAPRPIPPPELLPKTLTVADVKAKFP 1630

  Fly   590 GHLKNRG----SAVGSGKPHGQMMNGHV 613
            .:.:.:|    :.|...|.:..::.||:
 Frog  1631 KNAEMKGYCPVTYVDGNKRYEALVPGHI 1658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 51/295 (17%)
ADK 70..230 CDD:238713 49/284 (17%)
aden_kin_iso1 358..521 CDD:130427 51/253 (20%)
ADK 359..521 CDD:238713 51/252 (20%)
ak9XP_017949804.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121793095
eggNOG 1 0.900 E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.