DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9541 and ak5

Sequence 1:NP_001260273.1 Gene:CG9541 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001093554.1 Gene:ak5 ZFINID:ZDB-GENE-030131-8256 Length:563 Species:Danio rerio

Alignment Length:493 Identity:112/494 (23%)
Similarity:201/494 (41%) Gaps:132/494 (27%)


  Fly    63 FDP--PKVPVIFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQYAMGN--DMQDFSQLS--- 120
            |||  |:..||.::|||||||.|.| ..:.||.|..::::.:||::..:.|  ..:.:|.::   
Zfish   125 FDPSRPRPKVILIIGGPGSGKGTQC-LKIAERYGFEYVSVGELLRKKMIHNATSNRKWSLIARII 188

  Fly   121 --------SKTVTEVLMLEMKMAPAAKAYLISGYPRSMRDVVEYSEKIQVVNGVILISWRQSVLQ 177
                    ..|:||:....||: |.|...:|.|:||.:...:.:.:::...:.|:.::.....|:
Zfish   189 TNGELAPQETTITEIKQKIMKI-PEASGIVIDGFPRDVGQALSFEDQVCTPDLVVFLACSNQRLK 252

  Fly   178 KQIDYGAKLGHVVLSLAK---MELENFFKNVMPVADYFDQSDMLLAVNGERAPTEVYKDFRTAVL 239
            ::::..|:.........|   ..|.||.:|.:|:..||.:..:::.::.:|...||:       .
Zfish   253 ERLEKRAEQQGRPDDNPKAIDRRLTNFKQNAIPLVKYFQEKGLIVTLDADRDEEEVF-------Y 310

  Fly   240 DILSTLEN-----QEAVMNGVTGMGRGIHDIPGSIVSVDTAPSQAQQGTQIAEDNDVTNASETAG 299
            ||..|::|     :|.|        .|..::..|:::..::.:..........|.:|...:|..|
Zfish   311 DISMTVDNKLFPTKEPV--------AGPSELDLSLIADSSSLTDVPAKFDEQADEEVAEYAEAIG 367

  Fly   300 TVLARDLAIERMDGGPNGAVTALKTGTTSADDDSGVVVTQQPKLRQAAGPDESGSDLPPIIWVIG 364
                                            :|..:.|::.|                :|:|||
Zfish   368 --------------------------------ESFPMETKKSK----------------VIFVIG 384

  Fly   365 GPGSNKA-------------TLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAA 416
            ||||.||             .||...:..:...:|...||.||::                 |..
Zfish   385 GPGSGKALQSEKIEERYSLKRLCPGDILCSELQSHSERGRFLRDL-----------------LER 432

  Fly   417 GDMAPEKSLNQLL-ETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRG 480
            |:..||.:|..|| |.....:|...|.:|.|:|:|.:|.:.:|.|..|...::||:||.      
Zfish   433 GEQLPEDTLLDLLCEAMASTVRQGKGFLVTGFPKNEKQAQEYEAKMGQPDIVLLLECSA------ 491

  Fly   481 RIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDG 518
               |.:|   |||:.....:|...:..|...|.: |||
Zfish   492 ---DIMS---RRLQQRATCSLHSKEARDRDTRRR-VDG 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427 43/187 (23%)
ADK 70..230 CDD:238713 42/176 (24%)
aden_kin_iso1 358..521 CDD:130427 50/176 (28%)
ADK 359..521 CDD:238713 50/175 (29%)
ak5NP_001093554.1 aden_kin_iso1 133..317 CDD:130427 46/193 (24%)
ADK 134..308 CDD:238713 42/176 (24%)
aden_kin_iso1 375..562 CDD:130427 51/195 (26%)
ADK 379..552 CDD:238713 50/175 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121815330
eggNOG 1 0.900 E1_COG0563
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4968
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.