DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18088 and CG6236

Sequence 1:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_650446.2 Gene:CG6236 FlyBaseID:FBgn0038318 Length:680 Species:Drosophila melanogaster

Alignment Length:733 Identity:182/734 (25%)
Similarity:305/734 (42%) Gaps:155/734 (21%)


  Fly    15 LALCCFLTIVLFLIYSSNTSSNTNHDLYPPTTRFSRVSVKAEPQKFFVKTSKCHIPYVDPFNDEA 79
            :|.||.:.::|...|..|...:.:..|        ::.:.....:..|...:|..|::...|.:.
  Fly    12 IAACCCVVVLLVTWYVLNVERDLDKSL--------KIEIIERSIRSAVNRGECRHPHLPLDNPDI 68

  Fly    80 MELYKPQTLITCSNETDLISTTYNEIIKRHILHIDDEVAQK----LLNFTD----KDYNCFYREI 136
            |:.|||...|.|....|.:      :.::.|..:..|:|..    :.::||    .||     ::
  Fly    69 MKFYKPVERINCGEGMDWV------MCEKSICFVRPEIASSHEDVICSYTDIIRKSDY-----KV 122

  Fly   137 KYGKIADTYDNLKAKKYFTSGYEVPVHVEGMIVECQTADDPIVVLQK---DAFAFIQH------- 191
            ::|:      :|:.|:.:.               .|.:|...||.:.   :::..:.|       
  Fly   123 RFGQ------SLRMKEPYV---------------LQASDFVKVVCRSSSGESWFGMAHGIRDTVP 166

  Fly   192 RPLPKDSIRPRAARKP--------------------SVIMYGIDSLSRINLRRTMPKVFNFL-QG 235
            || |..:..|..|..|                    :|:|:|.|||||....|.:|:.:.:| |.
  Fly   167 RP-PASNFSPNLAVLPPEAVAQAQQQMQDGATAPIYNVLMFGFDSLSRNAFIRKLPRTYEYLTQQ 230

  Fly   236 PGWYEMQGYNKVADNSFPNILAILSGYSASTAKENVCDTDKQGCLDEMPMIWKYFKNASYLTGYA 300
            .|...::|||.|.|.:...::.:|:|::.....|........|.:|..|||||.|....|:|.:.
  Fly   231 LGATVLKGYNIVGDGTPQALVPLLTGFTELELPETRKRLSGAGSVDSYPMIWKDFARLGYMTSFN 295

  Fly   301 EDESNSNHFNYLKPGFSKKPMDYYFRPLL-----RALESEMD-VYRLPEHDYMRYCLGRRIANRY 359
            ||..|...|.|...||..:|:|:|.|...     .|.||:.: :...|:|..|            
  Fly   296 EDLPNVGTFTYRMTGFEAQPVDHYLRTYYVQAEHMAAESKPNCIGHQPDHITM------------ 348

  Fly   360 IYDYGLQFTKRFV---HDRPIWGMFWSNHFSHDDPFMPSAMQEKVLGDLIDMHADGQFEEMIMIF 421
                 |::||.|:   .|.|.:...:....|||...:..|..:.|...|:.:......::.|:|.
  Fly   349 -----LEYTKNFMLKYRDAPRFAFSFHGGLSHDSINLVGAADDDVHDWLVALKERSLLDDTILIM 408

  Fly   422 FADHGTRFGDLTYLKEGFLEERLPMMFIYLPPWFRETYPSYVRALELNQHRLSSNFDLHNTLKHI 486
            .||||.||.::....:|..|||||......|..|::.:|...:....|:|.|::.||:|.||||:
  Fly   409 MADHGNRFAEVRATLQGKQEERLPFFSFVFPESFKKRFPQEYKNFLANEHHLTTPFDIHATLKHV 473

  Fly   487 IEI-------GGTPDGRELPKSFDCP-----------TCQSLFYPLPEGRTCSEAGIEEHWCTCE 533
            |::       |...|    ||:...|           ...||..|:|..|:|::|.||.|||.|.
  Fly   474 IQLQTAVDQFGEIND----PKTETSPPGIRISELARGRAMSLLDPIPSNRSCADAYIEPHWCACL 534

  Fly   534 PYKIISGQD--WTTPI---AHSVIDRMNEYFVQKNLTSLCSNLTLNYV--------HKTEIKTGL 585
            .:..:...|  :|..|   |.|:::.:|...|::.  ..|:.|.::.|        ||..::...
  Fly   535 NWLPLQLNDSRYTGIILKAAQSIVNAINLATVEQR--QYCAPLEIHRVNWALRLQPHKELLQFRT 597

  Fly   586 NID--------WHQTLMESETAVYRIKFKVKQNSADFQATVVYHNSTQNAQVNVEKISRTNSYKE 642
            |.|        ..|||:..|  :|:::.........|:|:|.|...|.:|...:..|||.|.|..
  Fly   598 NSDRDGFLADMTGQTLVRDE--MYQLQVVTMPGEGLFEASVAYSLHTFSATTKLTDISRVNKYGN 660

  Fly   643 DSTCIDDKLAKL--YCIC 658
            .:.||.|:..:|  ||.|
  Fly   661 QARCIYDRDPELRKYCYC 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 142/572 (25%)
ALP_like 207..489 CDD:293745 89/312 (29%)
CG6236NP_650446.2 DUF229 73..581 CDD:281053 142/564 (25%)
ALP_like 201..477 CDD:293745 88/293 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.