DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18088 and CG11630

Sequence 1:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster

Alignment Length:711 Identity:171/712 (24%)
Similarity:285/712 (40%) Gaps:158/712 (22%)


  Fly    18 CCFL-TIVLF-LIYSSNTSSNTN-----HDLYPPTTRFSRVSVKAEPQKFFVKTSKCHIPYVDPF 75
            |||| ::::| .:|..|.....|     |.|.               :|:.|.|..|.:..:.|.
  Fly     8 CCFLYSLIIFSFVYYYNDVVVDNIIFEEHHLV---------------EKYSVDTKGCRMLTMVPN 57

  Fly    76 NDEAMELYKPQTLITCSNETDLIS---TTYNEIIKRHILHIDDEVAQKLLNF-----TDKDYNCF 132
            ..:.|.|::......|::..:|.|   .|||        ::..||..:|...     |.:.:.|.
  Fly    58 EYDVMFLWRGLRRDFCASNLNLTSFSNCTYN--------YLRTEVNMELAKARFGVETLESFKCM 114

  Fly   133 YREIKYGKIADT-YDN--LKAKKY--FTSGYE-VPVHVEGMIVECQTADDPIVVLQKDAFAFIQH 191
            |    |.....| :||  |.::::  .|.|.. :..|.:.:..||......|.    :...|..|
  Fly   115 Y----YAMERHTDFDNRYLYSREFELLTDGNNTIEPHADIIRAECFINATSIY----NGVHFYVH 171

  Fly   192 RPLPKDS-IRPRAARKP----------SVIMYGIDSLSRINLRRTMPKVFNFLQGPGWYEMQGYN 245
               |.|. :|......|          ||::.|:||:|:::..|:|.:..|||......|::|:|
  Fly   172 ---PTDEWLRTAQGLPPLKLASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFN 233

  Fly   246 KVADNSFPNILAILSGYSASTAKENVCDTDKQGCLDEMPMIWKYFKNASYLTGYAEDESNSNHFN 310
            ::.::.|.:::.:|||.|....|:   .:.....||..|.|||.|:.|.|.||..||..:.:.| 
  Fly   234 RLGEDGFDSLMPLLSGLSGQELKD---VSSNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLF- 294

  Fly   311 YLKPGFSKKPMDYYFRPLLRALE---------------SEMDVYRLPEHDYMRYCLGRRIANRYI 360
              ..||.|.|.|:|.||.|  ||               :|.|.|.:...:::...|....::|: 
  Fly   295 --VKGFRKPPTDFYLRPAL--LEMWLKTRTDGLFGTHCNEKDNYAMVLREFLFKMLPHHTSHRF- 354

  Fly   361 YDYGLQFTKRFVHDRPIWGMFWSNHFSH--------DDPFMPSAMQEKVLGDLIDMHADGQFEEM 417
                  ||.       :|   |:....|        |.||:   ...|.:|      ..|..:..
  Fly   355 ------FTF-------LW---WTQGIDHLFNYGRKLDQPFL---KMFKAIG------RSGLLKNT 394

  Fly   418 IMIFFADHGTRFGDLTYLKEGFLEERLPMMFIYLPPWFRETYPSYVRALELNQHRLSSNFDLHNT 482
            :::..::||...|......:|.:||..|:..:..|.|..|.||..:..|:.|..||.:.||||.|
  Fly   395 VLLVVSNHGLNKGRFYKTVQGKVEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHAT 459

  Fly   483 LKHIIEIGGTPD-------------GRELPKSFDCPTCQSLFYPLPEGRTCSEAGIEEHWCTC-E 533
            |:::..:....|             |:::|:..      |||.|:|:.|.|..|.|....|.| :
  Fly   460 LQNLPNLTSLEDEQLQQRRVDLWAMGKDIPRGI------SLFLPIPDHRDCFLAAIPTANCLCQQ 518

  Fly   534 PYKIISGQDWTTPIAHSVIDRMNEYFVQKNLTSLCSNLTLNYVHKTEIKTGLNIDWHQTLMESET 598
            |..:.:...:....|..:|..:|:..  ...|..|..|.|:.|        |..|..:.:.:...
  Fly   519 PRNVSTSDGYVQRAARLIIRNLNKMI--HTHTPPCKTLYLDRV--------LTADKWRRIADEHQ 573

  Fly   599 AVYRIKFKVKQNSADFQATVVYHNSTQNAQVNVE-KISRTNSYKEDSTCIDDKLAKLYCIC 658
            :.:|::.........|:..|.|    ...::.|: .|||.|.|:..|.||.:.|.::||.|
  Fly   574 SEFRVRLIATPGEGQFEGIVRY----TGYKLAVDGHISRVNDYRNGSQCIRNYLIEMYCFC 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 135/555 (24%)
ALP_like 207..489 CDD:293745 84/315 (27%)
CG11630NP_610124.1 DUF229 66..560 CDD:281053 135/563 (24%)
ALP_like 195..467 CDD:293745 83/306 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49552
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.