DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18088 and CG16854

Sequence 1:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001245974.1 Gene:CG16854 FlyBaseID:FBgn0032338 Length:705 Species:Drosophila melanogaster

Alignment Length:650 Identity:180/650 (28%)
Similarity:292/650 (45%) Gaps:98/650 (15%)


  Fly    60 FFVKTSKCHIPYVDPFNDE-AMELYKPQTLITCSNETDLISTTYNEIIKRHILHIDDEVAQKLLN 123
            :||.|:.|.:|:.:..:|. |..::||:. .:|:..  ||.|  ::.|... ||::.|.::.|..
  Fly   101 YFVDTTGCRMPHFEVSDDTIAQFIFKPRP-YSCNRA--LIRT--SDTIPGQ-LHLNLEASELLAY 159

  Fly   124 FTDKD---YNCFYREIKYGKIADTYD------NLKAKKYFTSGYEVPVHVEGMIVECQTADDPIV 179
            :...|   .||.|.|:|  :..|:.:      :.|..|..    ::|:..|.:.:.|..:.|.: 
  Fly   160 YNISDLSSVNCNYTEVK--RKTDSSNTHSPAVSFKLDKVM----KLPLSSEFICMWCYDSLDKL- 217

  Fly   180 VLQKDAFAFIQHRPLPKDSIRP---------------RAARKPSVIMYGIDSLSRINLRRTMPKV 229
             ..||...|...:|    .|||               ....:.||::.|:||||.:|..|.|.:.
  Fly   218 -FYKDCHFFAVDKP----RIRPPLKTGTDRVSFNKSKEEQERLSVMILGMDSLSHLNFLRQMRRT 277

  Fly   230 FNFLQGP-GWYEMQGYNKVADNSFPNILAILSGYSASTAKENVCDTDKQ-GCLDEMPMIWKYFKN 292
            .|:::.. ...|..|||||.||:|||::.:|||  ....:.|:..|.|. ...|....|||.::.
  Fly   278 ANYVRKHLSHVEFWGYNKVGDNTFPNLVPLLSG--LDDQELNLACTPKTLRSYDRCSFIWKRYQQ 340

  Fly   293 ASYLTGYAEDESNSNHFNYLKPGFSKKPMDYYFRPLLRALESEMDVYRLPEHDYMRYCLGRRIAN 357
            ..|.:.:|||.:..:.|||.:.||.|:|.|||.||::..:|..:   ...:...|..|:|.|...
  Fly   341 LGYRSIFAEDVAMLSAFNYNQNGFRKQPTDYYLRPMIMEMEKTV---AFKKDLNMHLCMGSRRTA 402

  Fly   358 RYIYDYGLQFTKRFVHDRPIWGMFWSNHFSHDDPFMPSAMQEKVLGDLIDMHADGQFEEMIMIFF 422
            ..:.:|..:...|...|. .:..||:...:||....||.:.|.:|..|:.:...|.....:::..
  Fly   403 DVLLEYMKKLVPRMSRDL-YFSFFWTVALTHDYFNFPSLLDEAMLQQLMQLQDSGLLNRTVVMLL 466

  Fly   423 ADHGTRFGDLTYLKEGFLEERLPMMFIYLPPWFRETYPSYVRALELNQHRLSSNFDLHNTLKHII 487
            :|||.|:|......:|.:|||.|:|.:..|||..|.||..:..|.||..||::.||:|.|:..::
  Fly   467 SDHGLRWGSFRRTYQGMMEERQPLMMLLYPPWMTERYPEAIANLRLNARRLTTPFDVHATMLQLL 531

  Fly   488 EIGG--------------TPDGRELPKSFDCPTCQSLFYPLPEGRTCSEAGIEEHWCTCEPYKII 538
            .:..              .||. .||:..      |||.|:|..|||.:|||..|||||...:.:
  Fly   532 NLHNLEADQLQRRSTEMDEPDS-TLPRGI------SLFLPIPAARTCEQAGIAAHWCTCHQRQEL 589

  Fly   539 SGQDWTTPIAHSVIDRMNEYFVQ------KNLTSLCSNLTLNYVHKTEIKTGLNIDWHQTLMESE 597
            ...|       ..:.|...|.|:      |: :|.|..|.||.:.:..|...     |..::::.
  Fly   590 QTND-------PRVQRAARYLVRLINNRLKD-SSQCRTLYLNSILQALIAAP-----HSKIVKNI 641

  Fly   598 TAVYRI----KFKVKQNSADFQATVVYHNSTQNAQVNVEKISRTNSYKEDSTCIDDKLAKLYCIC 658
            :..|.:    :.:.|.....|::||   ..|....|....|||.|.|...|.|::|...|::|.|
  Fly   642 STDYAVDITLRLQTKPGLGVFESTV---RMTGYTTVLTGTISRLNLYGSQSYCLNDPALKMFCYC 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 153/539 (28%)
ALP_like 207..489 CDD:293745 92/284 (32%)
CG16854NP_001245974.1 DUF229 126..626 CDD:281053 153/539 (28%)
ALP_like 255..533 CDD:293745 92/284 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49574
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.