DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18088 and T07G12.3

Sequence 1:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_501945.2 Gene:T07G12.3 WormBaseID:WBGene00011594 Length:623 Species:Caenorhabditis elegans

Alignment Length:656 Identity:150/657 (23%)
Similarity:263/657 (40%) Gaps:117/657 (18%)


  Fly    48 FSRVSVKAEPQKFFVKTSK-----CHIP---YVDPFNDEAMELYKPQTLITCSNE----TDLIST 100
            |:..|.|.|.:..::.:|:     |.:|   |.|......|..|.|..  .|...    |:|:::
 Worm    25 FNNGSTKIESKFLYLDSSRSAHNICALPIYDYWDTSIKNVMHEYNPAR--NCYKNYVQWTELVNS 87

  Fly   101 TYNEIIKRHILHIDDEVAQKLLNFTDKDYNCFYREIKYGKIADTYDNLKAKKYFTSG-YEVPVHV 164
            |: .|:|                   ...||         :|..:..:...|....| :..|.||
 Worm    88 TW-RIVK-------------------DGANC---------LARCFSGIGGSKNVKIGPWMKPGHV 123

  Fly   165 EGMIVECQTADDPIVVLQKDAFAFIQHRPLPKDSIRPRAARKPSVIMYGIDSLSRINLRRTMPKV 229
            :...:|....:|.|     :.:..|..:.:|:.:...:....|:|.::.||:::....:|:.||:
 Worm   124 DCEFLETVCWEDNI-----EVYGHIHTQIIPRKASPTKFKDAPNVFIFTIDAMNTGMAKRSFPKL 183

  Fly   230 FNFLQGPGWYEMQGY---NKVADNSFPNILAILSGYSAS-----TAKENVCDTD-KQGC---LDE 282
            .::.:..  ::|..:   |||.:||.||.|.:..|.|..     |..:...|.| .|.|   ||.
 Worm   184 LSYFKNE--FQMIEFPFVNKVGENSRPNGLPLWFGKSIEGGRRVTGDDVEVDWDWNQYCETYLDN 246

  Fly   283 MPMIWKYFKNASYLTGYAED-ESNSNHFNYLKPGFSKKPMDYYFRPLLRALESE-MDVYRLPEHD 345
            ...|:|.||:..|.|...|| |.|.........||.:.|.|:.|||.....|:. |::.:  .|.
 Worm   247 SSHIFKDFKDHGYATMLFEDWEGNVVDSWPTCVGFEEPPTDHTFRPFASVSETHGMEITK--RHL 309

  Fly   346 YMRYCLGRRIANRYIYDYGLQFTKRFVHDRPIWGMFWSNHFSHD--DPFMPSAMQEKVLGDLIDM 408
            ..::|.....|...:.:.|::..|    ||||:...|....:||  |   .:|..::.|.:....
 Worm   310 SGKFCRETHHAIMELLEQGIEAYK----DRPIFSWLWLAWVAHDWID---GAARVDEYLVNYFKK 367

  Fly   409 HADGQFEEMIMIFFADHGTRFGDLTYLKEGFLEERLPMMFIYLPPWFRETYPSYVRALELNQHRL 473
            | :..|:...::|.:|||.|.|.....:.|..|...|.:.|.:|..||.|....:..|..:..:|
 Worm   368 H-NNMFDNSFVMFVSDHGLRTGKHMRTEIGAFERDNPFLSISIPKRFRATKFGILETLNFDSKQL 431

  Fly   474 SSNFDLHNTLKHIIEIGGT-----------PD--GREL-PKSFDCPTCQSLFYPLPEGRTCSEAG 524
            .::||:..||..|::...|           ||  |..| .|..|.|            |||:...
 Worm   432 QTHFDVRATLLDILKFQPTSKFMDRQQKNIPDEKGHSLIRKQPDFP------------RTCATLP 484

  Fly   525 IEEHWCTCEPYKI-ISGQDWTTPIAHSVIDRMNEYFVQKNLTSLCSNLTLNYVHKTEIKTGLNID 588
            |.:.||.|:..|. |..:.....:...:::.::....:.|::.:|....|     :::.:.:...
 Worm   485 IPQQWCICQVDKFEIHNETLKNHLGEKLLNHVHRKLKKLNVSEICETFRL-----SKVTSLIEYG 544

  Fly   589 WHQTLMESETAVYRIKFKVKQNS-ADFQATVVYHNSTQNAQVNVEKISRTNSYKEDSTCIDDKLA 652
            :.:|:     ..|:|..:...:| |.|:..|.|...|..|:  .||::|.::|...:.|......
 Worm   545 YVRTM-----RTYKISVETTISSYAHFETFVTYDIETDIAK--FEKVTRLDNYAMTTDCTKPIRQ 602

  Fly   653 KLYCIC 658
            ...|.|
 Worm   603 SPLCYC 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 122/529 (23%)
ALP_like 207..489 CDD:293745 82/298 (28%)
T07G12.3NP_501945.2 DUF229 67..538 CDD:281053 123/536 (23%)
ALP_like 161..448 CDD:293745 82/299 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.