DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18088 and M03F8.5

Sequence 1:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_504546.2 Gene:M03F8.5 WormBaseID:WBGene00019764 Length:417 Species:Caenorhabditis elegans

Alignment Length:412 Identity:91/413 (22%)
Similarity:162/413 (39%) Gaps:80/413 (19%)


  Fly    23 IVLFLIYSSNTSSNTNHDLYPPTTRFSRVSVKAEPQKFFVKTSKCHIPYVDPFNDEAMELYKPQT 87
            |.||.|.|.      :|..:.|..:....:.....::..:..:.|...:.||.:....:..|...
 Worm    20 ICLFYIVSQ------SHLNFKPNLKLEFRNFSEPHRQAHLFDNYCKFAWTDPMDSTLKKRLKFPK 78

  Fly    88 LITCSNETDLISTTYN-EIIKRHILHIDDEVAQKLLNFTDKDYNCFYREIKYG--------KIAD 143
            ..:|..        || ::.||:  ....|.:.||.::.: :..|..:.:|.|        |:..
 Worm    79 HASCEK--------YNIDLFKRY--PATGEFSMKLKSYKN-NLECVAQVLKGGLRPEAHTFKLGR 132

  Fly   144 TYD-NLKAKKYFTSGYEVPVHVEGMIVECQTADDPIVVLQKDAFAF-IQHR-----------PLP 195
            |.: :.|..|.|.      ::.:..::.|.:..  :|:.:|..... :|.:           |.|
 Worm   133 TQNFSPKLNKRFW------INADNFLITCFSKQ--LVIYRKQFMGLNMQEKLPLVVDGSFVIPEP 189

  Fly   196 KDSIRPRAARKPSVIMYGIDSLSRINLRRTMPKVFNFLQGPGWYEMQGYNKVADNSFPNILAILS 260
            ..:.....:.:.|:.:.|:||.||....|.|.|....|...|......||||.|||..|:|.|.:
 Worm   190 DYTFHGEKSTRFSISILGLDSTSRAQFGRNMKKTSGLLDRLGSVVFNAYNKVGDNSAVNMLPIFA 254

  Fly   261 GYSASTAKENVCDTDKQGCL--------------DEMPMIWKYFKNASYLTGYAEDESNSN---- 307
            .....|  |::...|:.|.:              |.:..|||... ..|:|.|.:|..:::    
 Worm   255 NELQET--ESMSLIDETGDVNINKILPSKTPLNPDTIQWIWKQLP-PEYITMYNDDIMHTSRGLF 316

  Fly   308 HF---NYLKPGFSKKPMDYYFRPLLRALESEMDVYRLPEHDYMRYCLGRRIANRYIYDYGLQFTK 369
            |:   |:| .||||.|..:|:||....|.::|       :::.|.||..::......|...:| :
 Worm   317 HYPPDNFL-GGFSKPPAKFYYRPYYNHLYTQM-------NNWWRKCLDGQLLAEVFIDSWFRF-E 372

  Fly   370 RFVHDRPIWGMFWSNHFSHDDP 391
            |.....|.:|..:.:..:||||
 Worm   373 RVFGKLPHFGFTFISSLTHDDP 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 81/352 (23%)
ALP_like 207..489 CDD:293745 58/207 (28%)
M03F8.5NP_504546.2 ALP_like 201..>391 CDD:304875 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49799
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.