DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18088 and F32G8.2

Sequence 1:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_505706.3 Gene:F32G8.2 WormBaseID:WBGene00009338 Length:561 Species:Caenorhabditis elegans

Alignment Length:704 Identity:117/705 (17%)
Similarity:227/705 (32%) Gaps:230/705 (33%)


  Fly     5 ICSSYSLYK------FLALCCFLTIVLFLI-------YSSNTSSNTNHDLYPPTTRFSRVSVKAE 56
            :||..:..|      |..|.|.|  ::|::       |::|......:: |..|.:.:|..:   
 Worm     2 LCSLKNQVKIFPSLIFAILSCLL--IIFIVGITHKANYNTNVGFEKKYE-YAYTMQDTREQL--- 60

  Fly    57 PQKFFVKTSKCHIPY--------------VDPFNDEAMELYKPQTLITCSNETDLISTTYNEIIK 107
                   .:.|..|:              |||                   |.|.:....|:.:.
 Worm    61 -------GNFCKFPFLFFANYDVEDGIYNVDP-------------------EDDCVPDELNKYVN 99

  Fly   108 RHILHIDDEVAQKLLNFTDKDYNCFYREIKYGKIADTYDNLKAKKYFTSGYEVPVHVE--GMIVE 170
            .....:.....|.:.|.:.:...|.|:.          :|..:|::|.....||:.:.  ..:|.
 Worm   100 FSTTSVLTYRPQPITNLSLEPIRCAYQT----------NNGLSKQFFEIEPNVPIQIPHYNFLVS 154

  Fly   171 CQTADDPIVVLQKDAFAFIQHRPLPKDSIRPRAARKPSVIMYGIDSLSRINLRRTMPKVFNFLQG 235
            |:..:..:.|           :|.....:.|:.....||.:..:.|::.:...:.:.:....:|.
 Worm   155 CKRNEKEVFV-----------KPFVNFGVIPKEVPGESVAVILLPSINHMLFTKKIIRTKTVMQK 208

  Fly   236 PGWYEMQGYNKVADNSFPNILAILSGYSASTAKENVCDTDKQGCLDEMPMIWKYFKNASYLTGYA 300
            .|:...|..|......|.::|..| |.|:..:                  :::..|..::.|.::
 Worm   209 NGFKFAQMLNMKETKPFLDLLLEL-GISSEIS------------------VFQQAKKHNFTTFFS 254

  Fly   301 ----------EDESNSNHFNYLKPGF---------SKKPMDYYFRPLLRALESEMDVYRLPEHDY 346
                      .|.....|.||:....         .:|.||.....:...|||..:         
 Worm   255 GPQQIRELIDVDYDTMEHRNYISNNLIDENFCLQDGRKLMDDQLENMELFLESTSE--------- 310

  Fly   347 MRYCLGRRIANRYIYDYGLQFTKRFVHDRPIWGMFWSNHFSHDDPFMPSAMQEKVLGDLIDMHAD 411
                 .:..|..::.|||.|   :.:.|..:..||             :.:|:|           
 Worm   311 -----SKFFALMFLDDYGSQ---KSLIDFDLSNMF-------------TRLQQK----------- 343

  Fly   412 GQFEEMIMIFFADHGTRFGDLTY---LKEGFLEE-RLPMMFIYLPPWFRETYPSYVRALELNQHR 472
            |.|:          .|.|...||   .||...|: :.|...:.|.....:::.:....|.||.||
 Worm   344 GIFK----------STTFIVTTYNLSAKEVTDEQSKNPFFAVRLSDTLMKSHKTESHFLHLNFHR 398

  Fly   473 LSSNFDLHNTLKHIIEIGGTPDGRELPK-SFDCPTCQSLFYPLPEGRTCSEAGIEEHWCTCEPYK 536
            |.:..:.::.:.::::          || ||:.    |.|......|:|....:.:..|.|  .|
 Worm   399 LLTTSNSYHLIMNLLD----------PKTSFNL----SPFSLQSTTRSCQSENLSDEICLC--MK 447

  Fly   537 IISGQDWTTPIAHSVIDRMNEYFVQKNLTSLCSNLTLNYVHKTEIKTGLNIDWHQTLMESETAVY 601
            .|...|:..|:                        .:|::.|.|.:.|..|..::.:.       
 Worm   448 PIPVPDFINPV------------------------NINFMQKLEKEFGKEIKMYKCVQ------- 481

  Fly   602 RIKFKVKQNSADFQATVVYHNSTQNAQVNVEKISRTNSYKEDSTCIDDKLAKLY 655
              .|::...:|.|:    |.||....:: ||..::.....:....||..|.|.:
 Worm   482 --SFEMGNQTAFFE----YDNSKGKIRI-VELSAKARVLGKRRNIIDVPLKKTF 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 83/519 (16%)
ALP_like 207..489 CDD:293745 51/305 (17%)
F32G8.2NP_505706.3 ALP_like <297..414 CDD:304875 30/168 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49957
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.