DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18088 and F15H10.7

Sequence 1:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_505674.1 Gene:F15H10.7 WormBaseID:WBGene00008874 Length:666 Species:Caenorhabditis elegans

Alignment Length:730 Identity:174/731 (24%)
Similarity:310/731 (42%) Gaps:151/731 (21%)


  Fly     4 RICSSYSLY-KFLALCCFLTIVLFLIY----SSNTSSNTN-HDLYPPTTRFSRVSVKAEPQKFFV 62
            ||..:||.| .:.:....:.::.|.:|    .:.|..:|: |.||....|.|:            
 Worm     5 RIFYNYSHYITYYSKVALIFVICFGVYYGLFRTETDFSTHPHFLYLQKLRDSQ------------ 57

  Fly    63 KTSKCHIPYVDPFNDEAMELY-KPQTLITCSNETDLISTTYNEIIKRHILHIDDEVAQKLLNFTD 126
            ..|:|.||..||::...:..| ||..|:..:.:...:.:..|     .||..:.:|.        
 Worm    58 SKSECVIPDADPWDPSILSYYSKPSPLVCSTMQVQAVKSFNN-----GILTFEPQVI-------- 109

  Fly   127 KDYNCFYREIKYGKIADTYDNLKAKKYFTSGYEVPVHV------------EGMIVECQTADDPIV 179
            |:..|:...|::.:.....|.:         ||.||.:            |...:.|::.:    
 Worm   110 KNARCYKTGIRHDENVTDLDVI---------YEKPVPLNLTHTSSIKISDEVFQITCESDN---- 161

  Fly   180 VLQKDAFAFIQHRPLPKDS------IRPRAARKPSVIMYGIDSLSRINLRRTMPKVFNFLQGPGW 238
            :|:.:.|.:...:.:||.|      |....:..|||||.|:||:||.|..|.|.|.:.:::..|:
 Worm   162 LLKSEIFKYHYTQIVPKSSNIKNKVIEQSTSDFPSVIMIGLDSMSRGNFVRQMQKTYKYMKEAGF 226

  Fly   239 YEMQGYNKVADNSFPNILAILSGYSASTAKENVCDTDKQG--CLDEMPMIWKYFKNASYLTGYAE 301
            .:|:|:.|:.||::.|:||||:|......||...:.::..  ..||...|||.|.:..|.|.:||
 Worm   227 IDMEGHMKIHDNTYGNLLAILTGKRGVGVKEFSTEINESWHIAFDEFDFIWKTFSDNGYATLFAE 291

  Fly   302 DESNSNHFNY--LKPGFSKKPMDYYFRPL----------LRALESEMDVYRLPEHDYMRYCLGRR 354
            |..:...|.|  :..||.|:|.|:|.||.          .|::.|..|  ..|:|         :
 Worm   292 DRPDIGTFTYKNMLEGFLKQPTDHYIRPFWISAFWSLISRRSVASCYD--STPQH---------K 345

  Fly   355 IANRYIYDYGLQFTKRFVHDRPIWGMFWSNHFSH---------DDPFMPSAMQEKVLGDLIDMHA 410
            |..:|:.::..::.|     :..:..:||...||         ||.|      ||..     .:.
 Worm   346 IQLKYLEEFLEKYDK-----KRKFAFWWSQDMSHGFLNLIGKVDDDF------EKFF-----KNN 394

  Fly   411 DGQFEEMIMIFFADHGTRFGDLTYLKEGFLEERLPMMFIYLPPWFRETYPSYVRALELNQHRLSS 475
            :.:.|:.|:|.|:|||.|:..:.....|.:|.|:|...|.:|...::.||..|..|.:|...:::
 Worm   395 EKRMEDSIIIVFSDHGHRYDKIRETVIGRIESRMPFHSIRIPDGIKKKYPQIVENLMVNSKLMTT 459

  Fly   476 NFDLHNTLKHII--EIGGTPDGRELPKSFDCPTCQSLFYPLPEGRTCSEAGIEEHWCTC------ 532
            .||::::|:.|.  ::|......:..:|:      |.|.|.|:...|.||||...:|.|      
 Worm   460 QFDVNDSLRKIATGKVGEKWTQTDRKRSY------SYFDPFPKRIGCYEAGIPSDFCPCFSEIEI 518

  Fly   533 ----------EPYKIISGQDWTTPIAHSVIDRMNEYFV-QKNLTS-LCSNLTLNYVHKTEIKTGL 585
                      |..:|::.....|       ::..||.. .|.||. :|:.:.:..|..:.::..:
 Worm   519 PKSEAKEAAVELMRIVNDLLENT-------EKTEEYEPDSKELTEYMCTPMEIQNVEFSSVRLPM 576

  Fly   586 -----NIDWHQTLMESETAVYRIKFKVKQNSADFQATVVYHNSTQNAQVNVEKISRTNSYKEDST 645
                 ::....|.::|.:..|.:..:.|..|.....:.:.||...|...::.::.|.|.|...|.
 Worm   577 LSVLKDVKSEDTPLQSFSLQYHVVVRAKAPSNALLESTLEHNLKTNTWSSLGEVERNNKYGNTSF 641

  Fly   646 CIDDKLAKLYCICFS 660
            |::|::.|..|.|.|
 Worm   642 CVNDRILKKICHCIS 656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 135/554 (24%)
ALP_like 207..489 CDD:293745 89/307 (29%)
F15H10.7NP_505674.1 DUF229 79..568 CDD:281053 135/555 (24%)
ALP_like 195..472 CDD:293745 89/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.