DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG9988

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster

Alignment Length:662 Identity:280/663 (42%)
Similarity:415/663 (63%) Gaps:37/663 (6%)


  Fly    18 LCIFILFLLIVWKITSYGVN----------------DVLTIKYNEN-----QKRFYVNSSNCQMA 61
            ||..::.::::..|.:...|                |:...:.:.|     :..::|.|:.|::.
  Fly    12 LCFCLIAIIVILGIKTQNANTKPRVSEVTGSDDTNSDIPPAEEDRNVQDVVRPAYFVESAKCKIP 76

  Fly    62 YVEPFNAEFTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQN 126
            ||:||.::...::.|::|..|||::.|||..:|...::|||.::|.:...:..|...::.|:||.
  Fly    77 YVDPFASDAMAIFHPEHFETCSNETALVTPIYDISRQRYVLFINESLASIILNSNGGEYNCYYQE 141

  Fly   127 ITYGQSADHYDRMGKKTKFTHDYVVPLNVQGMLVEC-RSGDEKRILQEDAFSFVQYQKTSPNLDI 190
            ||..:..|.||:|.:| .|:.:|.|||:|:|:::.| |.|:|..|||.||::.:||:.....|.:
  Fly   142 ITRDRKHDSYDKMERK-YFSQNYEVPLHVEGLILTCHRLGNESDILQSDAYNLIQYRPPPKGLSL 205

  Fly   191 ---DRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPN 252
               .||.||:|:|||::||.||||.||.|:.||...||:|..||||:.|||:||:.:|||||:|.
  Fly   206 KPSKRKPSVLMFGIDSLSRINLRRTMPKVYKFLTRDGWFEQQGYNKIGDNTFPNLLAILTGYNPE 270

  Fly   253 SAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLD 317
            ||..::|:..:.||||:.||||...:...||||||||....|.|||.|||||.:|||:|.|||..
  Fly   271 SAIKKVCNWHEDGCLDRTPFIWHYFRNASYLTAYAEDEAGINTFNYWKPGFLEQPTDFYLRPLQK 335

  Fly   318 ALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSA 382
            |:|.......|..|.|.||:|||:.:||.:|..|.|..|:|.:|||||.||||..|||.|.|.|.
  Fly   336 AIESGLNTWKCSDCSMKYCIGRRITSSYAYDMARNFANRFVDERPIWGLFWSNSFSHDSFQMPSK 400

  Fly   383 MQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPR 447
            |:..::..||:||.||.|:.:||:|.||||||:|.||.....|||||.|.||||||||||.:||.
  Fly   401 MEDYVLQYLLDFEADGVFDQSIMVFLSDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPE 465

  Fly   448 YVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKW--SYDCPQCQSLFYELPESRSCSEAAIP 510
            |..||..|:|||:||:|::|||||||.:.|..:....  :.|||:||||||.:.|:|||.:|.||
  Fly   466 YARALELNRNRLTSNYDLHNTLKHIIELGGTPDGQTLPKAADCPKCQSLFYPVDETRSCEDAGIP 530

  Fly   511 EAYCTCHNYEEVQEDHGTW--RMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDE- 572
            |.:|||..|:.:...   |  .:|..|:.|||::|...||..:||.|||..:::||::: |.|: 
  Fly   531 EHFCTCVPYKRLDTQ---WAKSIAPKVIGRINEYLAGRNLSKICSELTLSYIHLTEMKV-ELDQN 591

  Fly   573 -HVSLGKG-LRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQK 635
             |..:.:. |..|.|.|:|.||.|:|.|||:::..|:.:::.|..|||::.|...::|:.|...|
  Fly   592 FHDDVPRAELGTYRTMFKVKQNSADFRATVIFNNVTDSVEVEVPTISRLDSYENVSTCVKDKTDK 656

  Fly   636 LFCICLSKLRNN 647
            ::|||...::::
  Fly   657 MYCICKCDIKDD 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG9988NP_651625.1 DUF229 90..580 CDD:281053 238/494 (48%)
ALP_like 212..493 CDD:293745 157/281 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914783
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.