DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG15695

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_650920.3 Gene:CG15695 FlyBaseID:FBgn0038832 Length:725 Species:Drosophila melanogaster

Alignment Length:602 Identity:218/603 (36%)
Similarity:333/603 (55%) Gaps:36/603 (6%)


  Fly    47 NQKRFYVNSSNCQMAYVEPFNAEFTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHK 111
            |.|:::|:|..|||::..||......:|...::..|....|::||:::.....|.||.:|     
  Fly   152 NGKKYFVHSPQCQMSHPNPFANNIQHIYKKHSYIVCDKSRDMITVNYNVTDSTYRLHKNE----- 211

  Fly   112 LSQSKSNKFACFYQNITYGQS--ADHYDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQED 174
                  |...||.|.:..|.|  |||..::|...:|..|::||..|..|:..||.....::.|:|
  Fly   212 ------NSTCCFKQILRAGTSANADHKYKLGPCVEFHQDFLVPTEVSAMITYCRRPPFDKVSQKD 270

  Fly   175 AFSFVQYQK---TSPNLDIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVAD 236
            |||||..:|   .:|.....|:.||:::|||::||.||...||.::.:|.:..|:|:.||||:.|
  Fly   271 AFSFVHPRKDQIENPTTPHRRRPSVLLWGIDSISRMNLELTMPRMYEYLNNQHWFELQGYNKMGD 335

  Fly   237 NTYPNIFSILTGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKP 301
            ||:||:.::|||::...| |..|...:...||..||||||.|..||.||:|||....:.|:|...
  Fly   336 NTFPNLMAVLTGFNKTYA-NARCHPEKVRGLDACPFIWKDFKDKGYTTAFAEDWSKFSTFDYSSR 399

  Fly   302 GFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQF--MQRYVADRPIW 364
            ||.:.|||.|.|||:.|:||| :.:...| :|.|||||:.|:.||:|...||  :.|   :...:
  Fly   400 GFFNPPTDVYGRPLVLAVEKE-LTILQRG-QMPYCLGRKPASEYIYDMGVQFTMVNR---NSTFF 459

  Fly   365 GFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEER 429
            |.||:|..||:||||.|||..::|..:...:|:|..::||:|||||||||||||......|:|||
  Fly   460 GMFWTNTFSHNDFSMPSAMDERMVKYMRTLDKNGIMDNTIIIFFSDHGSRFGPLRNLDSGFVEER 524

  Fly   430 QPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKWSYDCPQCQSL 494
            .|.::|.:|.|.|||||:.:..|..|:|||:|.:||:.||:||:.::...:.......|..|.|:
  Fly   525 LPFIYIRVPRWIREKYPKLLRNLQMNKNRLTSPYDIHATLRHILELDTPKDKLPRPDGCSSCHSV 589

  Fly   495 FYELPESRSCSEAAIPEAYCTCHNYEEV-QEDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLK 558
            |.|:..||:||:|.|.:.:|.|:::.:| ..|.....|:..:|:.||:::........||.|.|.
  Fly   590 FEEVDWSRNCSQAGIEDHWCACNSFSDVPTTDPSARSMSTQLVEAINEYVASKKGTKRCSRLKLN 654

  Fly   559 LVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYR 623
            .::..:.|          |...| |..:.......|.|.|||.:|...:.:...:..|||::.|.
  Fly   655 RISSVQRR----------GNSNR-YLIQLMAQPGDALFEATVDWDASAQRIPAQMPSISRLDTYA 708

  Fly   624 PDASCLDDNIQKLFCIC 640
            ..:.|......|.:|||
  Fly   709 AKSRCSSVKETKKYCIC 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG15695NP_650920.3 DUF229 180..656 CDD:281053 189/493 (38%)
ALP_like 293..571 CDD:293745 130/284 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4915000
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.