DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG6236

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_650446.2 Gene:CG6236 FlyBaseID:FBgn0038318 Length:680 Species:Drosophila melanogaster

Alignment Length:702 Identity:176/703 (25%)
Similarity:296/703 (42%) Gaps:110/703 (16%)


  Fly    15 KCILCIFILFLLIVWKITSY--GVNDVLTIKYNENQKRFYVNSSNCQMAYVEPFNAEFTKLYTPK 77
            |...|..::.||:.|.:.:.  .::..|.|:..|...|..||...|:..::...|.:..|.|.|.
  Fly    11 KIAACCCVVVLLVTWYVLNVERDLDKSLKIEIIERSIRSAVNRGECRHPHLPLDNPDIMKFYKPV 75

  Fly    78 NFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNITYGQSADHYDRMGKK 142
            ....|....|.|      :.::.:..|..|:     .|......|.|.:|.  :.:|:..|.|:.
  Fly    76 ERINCGEGMDWV------MCEKSICFVRPEI-----ASSHEDVICSYTDII--RKSDYKVRFGQS 127

  Fly   143 TKFTHDYVVPLNVQGMLVECRS-----------GDEKRILQEDAFSFVQYQKTSPNLDI------ 190
            .:....||:..: ..:.|.|||           |....:.:..|.:|      ||||.:      
  Fly   128 LRMKEPYVLQAS-DFVKVVCRSSSGESWFGMAHGIRDTVPRPPASNF------SPNLAVLPPEAV 185

  Fly   191 --------DRKA----SVIMYGIDTVSRTNLRRLMPVVFGFL-KSPGWYEMMGYNKVADNTYPNI 242
                    |...    :|:|:|.|::||....|.:|..:.:| :..|...:.|||.|.|.|...:
  Fly   186 AQAQQQMQDGATAPIYNVLMFGFDSLSRNAFIRKLPRTYEYLTQQLGATVLKGYNIVGDGTPQAL 250

  Fly   243 FSILTGYS----PNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGF 303
            ..:|||::    |.:.|.    .:..|.:|..|.||||..:.||:|::.||......|.|...||
  Fly   251 VPLLTGFTELELPETRKR----LSGAGSVDSYPMIWKDFARLGYMTSFNEDLPNVGTFTYRMTGF 311

  Fly   304 LSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFW 368
            .::|.|:|.|......|....:      ....|:|.:..:..:.:|.:.||.:| .|.|.:.|.:
  Fly   312 EAQPVDHYLRTYYVQAEHMAAE------SKPNCIGHQPDHITMLEYTKNFMLKY-RDAPRFAFSF 369

  Fly   369 SNHISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIM 433
            ...:|||..:::.|....:...|:..::....:.||:|..:|||:||..:..|.:...|||.|..
  Fly   370 HGGLSHDSINLVGAADDDVHDWLVALKERSLLDDTILIMMADHGNRFAEVRATLQGKQEERLPFF 434

  Fly   434 FIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIE------GLVEDTKWSYDCP--- 489
            ....|..|::::|:..:....|::.|::.|||:.||||:|.::      |.:.|.|.....|   
  Fly   435 SFVFPESFKKRFPQEYKNFLANEHHLTTPFDIHATLKHVIQLQTAVDQFGEINDPKTETSPPGIR 499

  Fly   490 -------QCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHGTW-----RMAELVVDRINQF 542
                   :..||...:|.:|||::|.|...:|.|.|:..:|.:...:     :.|:.:|:.||  
  Fly   500 ISELARGRAMSLLDPIPSNRSCADAYIEPHWCACLNWLPLQLNDSRYTGIILKAAQSIVNAIN-- 562

  Fly   543 LQYHNLQNLCSSLTLKLVN----------ITEVRITESDEHVSL----GKGL-RHYHTKFQVHQN 592
            |.....:..|:.|.:..||          :.:.| |.||....|    |:.| |....:.||...
  Fly   563 LATVEQRQYCAPLEIHRVNWALRLQPHKELLQFR-TNSDRDGFLADMTGQTLVRDEMYQLQVVTM 626

  Fly   593 LAE--FFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKL--FCIC 640
            ..|  |.|:|.|...|......:..|||:|.|...|.|:.|...:|  :|.|
  Fly   627 PGEGLFEASVAYSLHTFSATTKLTDISRVNKYGNQARCIYDRDPELRKYCYC 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG6236NP_650446.2 DUF229 73..581 CDD:281053 133/541 (25%)
ALP_like 201..477 CDD:293745 82/287 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.