DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG14731

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster

Alignment Length:681 Identity:171/682 (25%)
Similarity:306/682 (45%) Gaps:106/682 (16%)


  Fly    12 SYKKCILCIFILFLLIVWKITSYGVNDVLTIKYNENQKRFYVNSSNCQMAYVEPFNAEFTKLY-- 74
            |::..::||.:..|:...:...:.:.:...|:...:.|..:||||.||:..::||:.  |.:|  
  Fly    14 SFRLILMCIILYVLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSP--TAMYHM 76

  Fly    75 TPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQ---------NITYG 130
            ||...:.|.....:.....|.:...|::...:|:..||...:.:...|.|:         ||.:.
  Fly    77 TPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFNDFVNIYFE 141

  Fly   131 QSADHYDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQEDAFSFVQY---QKTSPNLDIDR 192
            .:...:.::...||.....:.      :.|.|.. |..|::..|.|.|:.:   ||.:.:..: :
  Fly   142 STLFRFSKLRNFTKVDSGNIT------LRVWCWM-DYGRLVYHDVFIFLPFPNPQKVNNSAPV-K 198

  Fly   193 KASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQ 257
            :.||::.|||::|..:.:|....|...::.....|:.|||:|..|:|||:..:|:|.|.:..:  
  Fly   199 RLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSVDEVE-- 261

  Fly   258 ICDTTQPGC--------LDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRP 314
                .:.||        .|:...:|.|.:..||.|.:.||:..:..|.|::|||..||||:|.|.
  Fly   262 ----AKSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRS 322

  Fly   315 LLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQF---MQRYVADRPIWGFFWSNHISHDD 376
            :::.:...: ..:..|...:.|.|.|:.:..::|:..:.   ||..:.||..:.|||.....||.
  Fly   323 VINEIHMRS-TYFARGPLEIKCSGDRVYHHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMGVHDY 386

  Fly   377 FS------------MLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEER 429
            |.            |.:..:.||:            |.|:::..||||.|:||.:.|.:...|..
  Fly   387 FQYGERADWEYYRIMRALKRRKIL------------ERTLVLIVSDHGLRYGPFVDTFQGMRETS 439

  Fly   430 QPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVED--------TKWSY 486
            .|||....|...||::|.....|..|.:||.:.:|::.|||.::::|.|.::        .:.::
  Fly   440 LPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRNNH 504

  Fly   487 DCPQCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHGTW------RMAELVVDRINQFL-Q 544
            :.    |||..:||.|||..|.||..||.|..|.::     .|      |:|:|.|..||:.| .
  Fly   505 NV----SLFLPIPEERSCFSARIPLHYCQCDGYVKI-----PWNVRSIQRIAKLAVANINRLLAP 560

  Fly   545 YHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEEL 609
            |...:.      |:|:|:.:..:.:  :| .|.|.:   ..:.........|.||||...:| .|
  Fly   561 YPQCEQ------LELLNVEDAYLRK--QH-KLNKTI---IVRLVTQPGNGHFDATVLSKNET-SL 612

  Fly   610 QINVELISRINIYRPDASCLDDNIQKLFCIC 640
            |   ..|:|.:.||..:.|..:...:::|.|
  Fly   613 Q---GPITRTDQYRHQSFCAREAPIEIYCYC 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG14731NP_650130.1 DUF229 77..573 CDD:281053 137/538 (25%)
ALP_like 200..485 CDD:293745 85/304 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49622
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.