DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG7120

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster

Alignment Length:679 Identity:220/680 (32%)
Similarity:346/680 (51%) Gaps:70/680 (10%)


  Fly    14 KKCILCIFILFLLIVWKITSYG-VN----DVL------TIKYNEN----------------QKRF 51
            :|.:|.:.:.|....:.|...| ||    |||      |:::...                .|.|
  Fly    42 RKSVLGLLVSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTVMDVEPEPITETNPSVPKGF 106

  Fly    52 YVNSSNCQMAYVEPFNAEFTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSK 116
            .|.|::|::..|:|:..|..:.:....:..|...:.|..|.|::..::|:|.:|.....:....|
  Fly   107 LVYSNSCRIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKFEAKSQKYLLSIDGAAFGRYPVGK 171

  Fly   117 SNKFACFYQNITYGQSADHYDRMGKKTKFTH------DYVVPLNVQGMLVECRSGDEKRILQEDA 175
              :..|.|      .|....|.|  |.|:|.      ..::|.:.:|::|:|.||..:..:...|
  Fly   172 --QLHCCY------MSVQRVDEM--KVKYTKCQTFKGSILLPDSAEGIIVKCDSGGRQIYINGHA 226

  Fly   176 FSFVQ---YQKTSPNLDIDRKA-----SVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYN 232
            ...|:   .|:.....:.|.|.     ||:|.|||::||.||.|.||....:|...||:|:.|||
  Fly   227 TVPVKEAVQQRLRMASEADAKGYQRPPSVLMLGIDSISRVNLIRAMPKTAQYLYDNGWFELAGYN 291

  Fly   233 KVADNTYPNIFSILTGYS-PNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIF 296
            ||.|||:|||.::||||: ||:.  ..|.....|.|||..:|||..::.||:||||||.|..|.|
  Fly   292 KVDDNTFPNIMAVLTGYNLPNAM--HACSPFVVGGLDKCDYIWKQYQQRGYVTAYAEDAVKINTF 354

  Fly   297 NYMKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADR 361
            ||:|.||.:.|.|||.||.|.|.|.:.......|  :|:|||...|..:::||..:|.:|:: :.
  Fly   355 NYLKKGFKNPPADYYLRPYLSAAESQLDHTTVNG--LVHCLGYLTAAEHVYDYGLEFTRRFL-NE 416

  Fly   362 PIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFL 426
            ..:||||:|..||.|.|..|:|...:...|....:.|:.|:|:::||||||.||||...|....|
  Fly   417 TYFGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDHGMRFGPTRATWSGHL 481

  Fly   427 EERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGL--VEDTKWSYDCP 489
            |||.|.:||:||...|..:|::|.:|..|:|||::.:|::.|:|||:.|.|.  :|....:.|||
  Fly   482 EERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISGRAEMESLGPAPDCP 546

  Fly   490 QCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHGTWRM-AELVVDRINQFL-QYHN--LQN 550
            |||||...:...||||:..|.:.:|||..|:.:.......|| .:.||..:|.:: ::.|  ...
  Fly   547 QCQSLLTPVSPQRSCSDVGIADHWCTCWEYDTISSTSKESRMLGKRVVSYLNNYVAEFRNGTFAK 611

  Fly   551 LCSSLTLKLVNITEVRITESDEHVSLGKGLRH-YHTKFQVHQNLAEFFATVLYDRKTEELQINVE 614
            ||:.|:|.     .::......|.:|.....| |...|....|..::.||:.::...:.:::...
  Fly   612 LCAPLSLH-----SIKSAFRAHHNALDPDEVHTYRLIFVTSPNKGQYEATLRHNHTDDSVKVTGS 671

  Fly   615 LISRINIYRPDASCLDDNIQKLFCICLSK 643
             :||:|:|..:|.|::|...|.:|.|..|
  Fly   672 -VSRLNVYSGEADCMNDFAAKKYCYCRKK 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 182/512 (36%)
ALP_like 253..528 CDD:293745 125/280 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914993
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.