DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG9168

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_612106.2 Gene:CG9168 FlyBaseID:FBgn0035216 Length:648 Species:Drosophila melanogaster

Alignment Length:651 Identity:250/652 (38%)
Similarity:376/652 (58%) Gaps:42/652 (6%)


  Fly    17 ILCIFILFLLIVWKIT--SYGVNDVLTIKYNENQKRFYVNSSNCQMAYVEPFNAEFTKLYTPKNF 79
            :|| .|.|||...|::  |:..|...|:   || |:|||:|.:|:|..::||:|:..:.:..:.|
  Fly     9 LLC-SIQFLLCKAKLSLHSHYPNVAKTL---EN-KKFYVDSPSCKMPEMDPFSADIMRFFKRRQF 68

  Fly    80 TRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFA-----CFYQNITYGQS---ADHY 136
            ..||:..||:...|||.|:||.:.:||    ..:|....||.     |.||.|...:.   .|::
  Fly    69 RECSSDKDLLISEFDSHLRQYRIKIDE----NSAQQHLKKFGNATLKCEYQVIGRNKKDSFPDNH 129

  Fly   137 DRMGKKTKFTHDYVVPLNVQGMLVECRS--GD-EKRILQEDAFSFVQ------YQKTSPNL-DID 191
            ....|....:..::||..:..:..:|.:  |: :.::||:|||.|||      ::.|..:. |:.
  Fly   130 FSFSKLQPLSQSFLVPKTIDFISTQCHAVHGNIDLKLLQKDAFLFVQDRLNHEHKNTEHHRPDLQ 194

  Fly   192 RKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKN 256
            .|.:||:.|||:.||.||||.||.|..||:.|||:||.|||||.:||.||:.:||||   |:.:|
  Fly   195 SKPNVIILGIDSTSRMNLRRSMPKVHKFLQRPGWFEMQGYNKVGENTLPNLLAILTG---NAEEN 256

  Fly   257 QICDTT--QPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDAL 319
            .:.:..  ..|.:||:.|||:..|||||:||:.||....|.|||.||||..:|.|:|.|..:.||
  Fly   257 ALFNGRFGHSGFIDKLKFIWQLFKKNGYMTAFGEDCAKINTFNYQKPGFKQQPVDFYLRNFIVAL 321

  Fly   320 EKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQ 384
              |||.........|:||||:|...|:||:.||||||:....|::|.||||..:|:||...:|:.
  Fly   322 --ETILKTRREFGNVFCLGRKLGFQYVFDFARQFMQRFENSAPVFGIFWSNSFTHEDFLGATALD 384

  Fly   385 HKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRES-FLEERQPIMFIYLPPWFREKYPRY 448
            |..:..|..:::.|.|..:|::..||||.|:|...:..:| :||||.|:|||::|||||:.||:|
  Fly   385 HVFLEYLTLYDELGFFNRSIVMVLSDHGYRYGVTRQASKSGYLEERLPLMFIHVPPWFRKIYPQY 449

  Fly   449 VEALAQNQNRLSSNFDIYNTLKHIINIEGL----VEDTKWSYDCPQCQSLFYELPESRSCSEAAI 509
            ||.|..|||||||.||::.||.|::::...    ......:..|..|||||::||.:|:||.|.|
  Fly   450 VENLKINQNRLSSGFDLHMTLHHLLHLNATSMADFSPKLQASQCKMCQSLFFQLPANRNCSHAGI 514

  Fly   510 PEAYCTCHNYEEVQEDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHV 574
            .|.:|:|...|.|.......::|:.||..:|:.|:..||..||.:..||.|...:.:|:.|::.|
  Fly   515 REKWCSCEPTETVTNQRLLRKVAQEVVHHMNRHLRDRNLTTLCQNYALKKVLYLDSKISLSEDSV 579

  Fly   575 SLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKLFCI 639
            . .:.|..|...|:.:.:.|.|.|||.::.:.|.|.:||:.:||:..|...:.|..|.|.|.:||
  Fly   580 E-DEQLHTYIITFETNPSSAHFEATVQWNSEKETLNMNVDELSRLESYEKHSKCTRDPIIKKYCI 643

  Fly   640 C 640
            |
  Fly   644 C 644



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914904
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.