DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG1428

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster

Alignment Length:691 Identity:165/692 (24%)
Similarity:276/692 (40%) Gaps:127/692 (18%)


  Fly     1 MMLKMKT---FTSVSYKKCILCIFILFL----LIVWKITSYGVNDVLTIKYNENQKRFYVNSSNC 58
            :||:||.   .|.|        .|.|:.    :..|    :...|::|..    ::..:||:|.|
  Fly     4 LMLRMKVSMILTGV--------FFTLYFGLQPVTEW----FERKDLVTAP----EEVVFVNTSVC 52

  Fly    59 QMA-YVEPFNAEFTKLYTPKNFTRCSNQSDLVTVHFD--SILKQYVLHVDEEVLHKLSQSKSNKF 120
            .:: ..:|  ..|.....|.|..||.....|..:..|  :.|:...:..|....:.|....:...
  Fly    53 HVSGQWKP--TAFYSAIEPVNKLRCRMTQLLTAITQDGSNFLEAKRISEDLSCRYWLKSGHTRNH 115

  Fly   121 ACFYQNITYGQSADHYD-RMGKKTKFTHDYVVPLNVQGMLVECRSGDE-KRILQEDAFSFVQYQK 183
            :..|  ..||    |:| :.|...|      :.:.....:|..|..|: |.....|...|:  ..
  Fly   116 SGHY--TAYG----HFDLKRGATRK------IKIGTGEQIVRIRCSDKFKASKYHDVLYFL--SP 166

  Fly   184 TSPNL---DIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSI 245
            ..|.|   :...|.||::.|||:||..:..|..|:|..||::....:..||::|..:...|:...
  Fly   167 PDPKLMSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVGLDANANLVPF 231

  Fly   246 LTGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSR---- 306
            |.|.|..:|.:.|..       |:..::|...|..||.|||.||..         .|.||.    
  Fly   232 LGGKSSRAAGSDILS-------DEKAWLWDSFKMEGYSTAYGEDNA---------KGILSNRNGD 280

  Fly   307 ------PTDYYFRPLLDALEKET---IKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRP 362
                  |.|:...|::..:...|   |.|.    :|::|...|.....:.|:..|.:. |:...|
  Fly   281 KELPKSPVDFDLTPVIVEMNNHTRYSIDLK----EMIHCTAGRKFQDVLRDFVLQLVP-YMQGMP 340

  Fly   363 IWGFFWSN--------HISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLM 419
            .:.|||.:        :..|.|.|.:..::..:..|:||        :|::...||||.|.|...
  Fly   341 FFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILN--------NTLLFLMSDHGLRAGEYR 397

  Fly   420 RTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKW 484
            .:.:...||.||:|....|.|.:.|||..|..|..|.:.|.:.:|:..||..:|.: |.::|...
  Fly   398 MSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIAL-GQLKDANI 461

  Fly   485 SYDCPQCQ-----------SLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHG-TWRMAELVVD 537
            .....:.|           |||..:|:.|:|..|.||..:|.|....||..|.| ..|.:..:|:
  Fly   462 EVSMKRLQSHPPNRLPRGISLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSRFMVE 526

  Fly   538 RINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNLAE--FFATV 600
            .|||.::..   ..|..|.|::|.:.        ..:..|:....|..:.:|..:...  :.|||
  Fly   527 SINQLIKPF---GQCRQLKLEMVLLA--------HFLDFGEESFVYELRLRVRTSPGNGVYEATV 580

  Fly   601 LYDRKTEELQINVELISRINIYRPDASCLDDNIQKLFCICL 641
                :..::.:....|||::.|...:.|:.|...::||:|:
  Fly   581 ----RLSDVLLLTSPISRVSHYLGQSHCIGDPDLQIFCLCI 617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG1428NP_610127.1 DUF229 68..547 CDD:281053 133/526 (25%)
ALP_like 180..453 CDD:293745 81/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49590
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.