DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG11630

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster

Alignment Length:683 Identity:168/684 (25%)
Similarity:295/684 (43%) Gaps:107/684 (16%)


  Fly    10 SVSYKKCILCIFILFLLIVWKITSYGVNDVL--TIKYNENQ--KRFYVNSSNCQMAYVEPFNAEF 70
            |.|.:.|.|...|:|..:      |..|||:  .|.:.|:.  :::.|::..|:|..:.|  .|:
  Fly     3 SCSIRCCFLYSLIIFSFV------YYYNDVVVDNIIFEEHHLVEKYSVDTKGCRMLTMVP--NEY 59

  Fly    71 TKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSK-----SNKFACFYQNITYG 130
            ..::..:...|....|:|....|.:....|   :..||..:|::::     ...|.|.|.     
  Fly    60 DVMFLWRGLRRDFCASNLNLTSFSNCTYNY---LRTEVNMELAKARFGVETLESFKCMYY----- 116

  Fly   131 QSADHYDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEKR--ILQEDAF-----------SFV--- 179
                   .|.:.|.|.:.|:.....: :|.:..:..|..  |::.:.|           .:|   
  Fly   117 -------AMERHTDFDNRYLYSREFE-LLTDGNNTIEPHADIIRAECFINATSIYNGVHFYVHPT 173

  Fly   180 -QYQKTSPNL-------DIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVAD 236
             ::.:|:..|       |:. ..||::.|:|::|:.:..|.|.....||.|....|:.|:|::.:
  Fly   174 DEWLRTAQGLPPLKLASDVG-SLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRLGE 237

  Fly   237 NTYPNIFSILTGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKP 301
            :.:.::..:|:|.|....|:.   ::....||..|||||..:|.||.|...||.:..::|   ..
  Fly   238 DGFDSLMPLLSGLSGQELKDV---SSNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLF---VK 296

  Fly   302 GFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGF 366
            ||...|||:|.||   ||.:..:|....|....:|..:   ::|.. ..|:|:.:.:.......|
  Fly   297 GFRKPPTDFYLRP---ALLEMWLKTRTDGLFGTHCNEK---DNYAM-VLREFLFKMLPHHTSHRF 354

  Fly   367 F----WSNHISHDDFSMLSAMQHKIVGDLLNFEK----DGSFEHTIMIFFSDHGSRFGPLMRTRE 423
            |    |:..|.|     |.....|:....|...|    .|..::|:::..|:||...|...:|.:
  Fly   355 FTFLWWTQGIDH-----LFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQ 414

  Fly   424 SFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTK----- 483
            ..:||.||:..:..|.|..|:||:.:..|..|..||.:.||::.||:::.|:..| ||.:     
  Fly   415 GKVEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSL-EDEQLQQRR 478

  Fly   484 ---WSY--DCPQCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHG-TWRMAELVVDRINQF 542
               |:.  |.|:..|||..:|:.|.|..||||.|.|.|.....|....| ..|.|.|::..:|:.
  Fly   479 VDLWAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNLNKM 543

  Fly   543 LQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTE 607
            :..|...  |.:|.|..|...:.....:|||.|      .:..:........:|...|.|  ...
  Fly   544 IHTHTPP--CKTLYLDRVLTADKWRRIADEHQS------EFRVRLIATPGEGQFEGIVRY--TGY 598

  Fly   608 ELQINVELISRINIYRPDASCLDDNIQKLFCIC 640
            :|.::.. |||:|.||..:.|:.:.:.:::|.|
  Fly   599 KLAVDGH-ISRVNDYRNGSQCIRNYLIEMYCFC 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG11630NP_610124.1 DUF229 66..560 CDD:281053 134/532 (25%)
ALP_like 195..467 CDD:293745 81/290 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49602
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.