DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG10730

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_610021.3 Gene:CG10730 FlyBaseID:FBgn0032843 Length:644 Species:Drosophila melanogaster

Alignment Length:674 Identity:254/675 (38%)
Similarity:361/675 (53%) Gaps:64/675 (9%)


  Fly     1 MMLKMKTFTSVSYKKCILCIFILFLLIVWKITSYGVNDVLTIKYNENQKRFYVNSSNCQMAYVEP 65
            |.|..|.|.:       |.|.|.|...:..:.. |.:|            :||.|..|||..|.|
  Fly     1 MTLSRKDFQA-------LLIVICFGFWIENLVQ-GADD------------YYVYSPVCQMPAVNP 45

  Fly    66 FNAEFTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSN-KFACFYQNIT- 128
            |..:....:..|....|.|.||:||..||....||.|||.|.:...:...|.| ...|.||.|: 
  Fly    46 FTWDTMSNFHRKTLRHCHNDSDMVTSEFDFETHQYRLHVHEHLAKPIMNRKGNATLECEYQEISR 110

  Fly   129 --YGQSADH-YDRMGKKTKFTHDYVVPLNVQGMLVECRSGD---EKRILQEDAFSFVQ------- 180
              ..|..|: |:::.::....|.: ||.|...|:..|...|   .:.:||:||.||::       
  Fly   111 DNSDQKPDNAYNQLRRRPIEQHQF-VPNNTDYMITSCYVRDVTKHRELLQQDAISFIEDRLPKEK 174

  Fly   181 ---YQKTSPNLDIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNI 242
               :.|....:   .|.||::.|:|:.||.||||.||.|:.|::.|||:||.|||||.|||:||:
  Fly   175 VKDFVKDESEV---HKPSVLIMGLDSTSRINLRRAMPSVYKFVRQPGWFEMQGYNKVGDNTFPNL 236

  Fly   243 FSILTGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRP 307
            .:.|||.|.... ...||.|:|||||.:.||||..||..|.||:|||....:.|||:||||:.:|
  Fly   237 LAALTGDSEKGV-GDYCDVTKPGCLDSLNFIWKRFKKANYTTAFAEDCSSISTFNYLKPGFVKQP 300

  Fly   308 TDYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHI 372
            ||||.||||.|:||:.......|  ..||:||.|:.||::|:.:||:.|::...|::||.|||..
  Fly   301 TDYYLRPLLFAIEKQFKVTNDFG--FAYCVGRHLSFSYVWDFGQQFIDRFLGRSPMFGFLWSNSF 363

  Fly   373 SHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYL 437
            :||.:...:|:.:.:...|.:||:...|:.:|:|..||||.|:..|.|....:.|||.|:|||||
  Fly   364 THDYYEGATALDNLLWKYLKSFEESNLFQKSIVILMSDHGHRYNTLRRASTGYFEERMPMMFIYL 428

  Fly   438 PPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGL----VEDTKWSYDCPQCQSLFYEL 498
            |||||.|||.....|.:||||||||:|:|.||:|::.::..    ..|...:..|..|||||:||
  Fly   429 PPWFRRKYPHLASNLGKNQNRLSSNYDVYMTLQHLLQLDSKSVDEFPDNLRARQCKSCQSLFFEL 493

  Fly   499 PESRSCSEAAIPEAYCTCHNYEEVQEDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNIT 563
            |.:|:|..|.|.|.:|.|...|.:........:||.:|.|:|:.|..|||.:||.:.||..|.  
  Fly   494 PFNRTCQMAGIEEKWCCCQPTETITNSPHVSTIAEAIVQRMNEHLISHNLSDLCHNFTLDYVE-- 556

  Fly   564 EVRITESDEHVSLGKGLRHYHTKFQVHQNLAE-------FFATVLYDRKTEE-LQINVELISRIN 620
                 ::|....|..|||......||:..:.|       |.|||.::.:|:. |..:||.:||:.
  Fly   557 -----KADRKTILSNGLRPADKNEQVYIIVFETVPKNPIFEATVRWNSRTQRLLHFDVEELSRLT 616

  Fly   621 IYRPDASCLDDNIQKLFCICLSKL 644
            .|:.||:|::....|.:|||...|
  Fly   617 SYKNDANCINRKNAKKYCICKDSL 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG10730NP_610021.3 DUF229 55..556 CDD:281053 208/508 (41%)
ALP_like 188..467 CDD:293745 137/282 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914873
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.