DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG16854

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001245974.1 Gene:CG16854 FlyBaseID:FBgn0032338 Length:705 Species:Drosophila melanogaster

Alignment Length:697 Identity:191/698 (27%)
Similarity:317/698 (45%) Gaps:112/698 (16%)


  Fly    13 YKKCILCIFILFLLIVWKITSYGVNDVLTIKYNENQK------------------------RFYV 53
            :||.::.||.|.      :.||     |.:.||...|                        .::|
  Fly    50 FKKVVIVIFALC------VFSY-----LCVDYNLRTKLLRFRDGFDFMARIEDHYGGNVTTAYFV 103

  Fly    54 NSSNCQMAYVEPFN---AEFTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQS 115
            :::.|:|.:.|..:   |:|  ::.|:.:: | |::.:.|  .|:|..|  ||::.|....|:  
  Fly   104 DTTGCRMPHFEVSDDTIAQF--IFKPRPYS-C-NRALIRT--SDTIPGQ--LHLNLEASELLA-- 158

  Fly   116 KSNKFACFYQNITYGQSAD-HYDRMGKKT----------KFTHDYV--VPLNVQGMLVECRSGDE 167
                    |.||:...|.: :|..:.:||          .|..|.|  :||:.:.:.:.|....:
  Fly   159 --------YYNISDLSSVNCNYTEVKRKTDSSNTHSPAVSFKLDKVMKLPLSSEFICMWCYDSLD 215

  Fly   168 KRILQEDAFSFVQYQKTSPNL--DIDR-----------KASVIMYGIDTVSRTNLRRLMPVVFGF 219
            |...::..|..|...:..|.|  ..||           :.||::.|:|::|..|..|.|.....:
  Fly   216 KLFYKDCHFFAVDKPRIRPPLKTGTDRVSFNKSKEEQERLSVMILGMDSLSHLNFLRQMRRTANY 280

  Fly   220 L-KSPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYL 283
            : |.....|..|||||.|||:||:..:|:|.. :...|..|........|:..||||..::.||.
  Fly   281 VRKHLSHVEFWGYNKVGDNTFPNLVPLLSGLD-DQELNLACTPKTLRSYDRCSFIWKRYQQLGYR 344

  Fly   284 TAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLANSYIFD 348
            :.:|||....:.|||.:.||..:|||||.||::  :|.|....:.....|..|:|.|.....:.:
  Fly   345 SIFAEDVAMLSAFNYNQNGFRKQPTDYYLRPMI--MEMEKTVAFKKDLNMHLCMGSRRTADVLLE 407

  Fly   349 YCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGS 413
            |.::.:.|...|. .:.|||:..::||.|:..|.:...::..|:..:..|....|:::..||||.
  Fly   408 YMKKLVPRMSRDL-YFSFFWTVALTHDYFNFPSLLDEAMLQQLMQLQDSGLLNRTVVMLLSDHGL 471

  Fly   414 RFGPLMRTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGL 478
            |:|...||.:..:|||||:|.:..|||..|:||..:..|..|..||::.||::.|:..::|:..|
  Fly   472 RWGSFRRTYQGMMEERQPLMMLLYPPWMTERYPEAIANLRLNARRLTTPFDVHATMLQLLNLHNL 536

  Fly   479 VED---------TKWSYDCPQCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQ-EDHGTWRMAE 533
            ..|         .:.....|:..|||..:|.:|:|.:|.|...:||||..:|:| .|....|.|.
  Fly   537 EADQLQRRSTEMDEPDSTLPRGISLFLPIPAARTCEQAGIAAHWCTCHQRQELQTNDPRVQRAAR 601

  Fly   534 LVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHT-----KFQVHQNL 593
            .:|..||     :.|::.....||.|.:|.:..|  :..|..:.|.:...:.     :.|....|
  Fly   602 YLVRLIN-----NRLKDSSQCRTLYLNSILQALI--AAPHSKIVKNISTDYAVDITLRLQTKPGL 659

  Fly   594 AEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKLFCIC 640
            ..|.:||   |.|....:....|||:|:|...:.||:|...|:||.|
  Fly   660 GVFESTV---RMTGYTTVLTGTISRLNLYGSQSYCLNDPALKMFCYC 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG16854NP_001245974.1 DUF229 126..626 CDD:281053 152/525 (29%)
ALP_like 255..533 CDD:293745 93/282 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49624
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.