DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG18088

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster

Alignment Length:671 Identity:341/672 (51%)
Similarity:445/672 (66%) Gaps:38/672 (6%)


  Fly     3 LKMKTFTSVS-YKKCILCIF--ILFLLIVWKITSYGVNDVL---TIKYN------ENQKRFYVNS 55
            ::::..:|.| ||...||.|  |:..||....||...|..|   |.:::      |.|| |:|.:
  Fly     1 MELRICSSYSLYKFLALCCFLTIVLFLIYSSNTSSNTNHDLYPPTTRFSRVSVKAEPQK-FFVKT 64

  Fly    56 SNCQMAYVEPFNAEFTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKF 120
            |.|.:.||:|||.|..:||.|:....|||::||::..::.|:|:::||:|:||..||.......:
  Fly    65 SKCHIPYVDPFNDEAMELYKPQTLITCSNETDLISTTYNEIIKRHILHIDDEVAQKLLNFTDKDY 129

  Fly   121 ACFYQNITYGQSADHYDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEK-RILQEDAFSFVQYQ-- 182
            .|||:.|.||:.||.||.:..|..||..|.||::|:||:|||::.|:. .:||:|||:|:|::  
  Fly   130 NCFYREIKYGKIADTYDNLKAKKYFTSGYEVPVHVEGMIVECQTADDPIVVLQKDAFAFIQHRPL 194

  Fly   183 -KTSPNLDIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSIL 246
             |.|......||.||||||||::||.||||.||.||.||:.||||||.||||||||::|||.:||
  Fly   195 PKDSIRPRAARKPSVIMYGIDSLSRINLRRTMPKVFNFLQGPGWYEMQGYNKVADNSFPNILAIL 259

  Fly   247 TGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYY 311
            :|||.::||..:|||.:.||||::|.|||..|...|||.||||...||.|||:||||..:|.|||
  Fly   260 SGYSASTAKENVCDTDKQGCLDEMPMIWKYFKNASYLTGYAEDESNSNHFNYLKPGFSKKPMDYY 324

  Fly   312 FRPLLDALEKETIKLYCPGCK-MVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHD 375
            |||||.|||.|......|... |.||||||:||.||:||..||.:|:|.||||||.|||||.|||
  Fly   325 FRPLLRALESEMDVYRLPEHDYMRYCLGRRIANRYIYDYGLQFTKRFVHDRPIWGMFWSNHFSHD 389

  Fly   376 DFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPW 440
            |..|.||||.|::|||::...||.||..|||||:|||:|||.|...:|.|||||.|:||||||||
  Fly   390 DPFMPSAMQEKVLGDLIDMHADGQFEEMIMIFFADHGTRFGDLTYLKEGFLEERLPMMFIYLPPW 454

  Fly   441 FREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVE--DTKWSYDCPQCQSLFYELPESRS 503
            |||.||.||.||..||:|||||||::|||||||.|.|..:  :...|:|||.||||||.|||.|:
  Fly   455 FRETYPSYVRALELNQHRLSSNFDLHNTLKHIIEIGGTPDGRELPKSFDCPTCQSLFYPLPEGRT 519

  Fly   504 CSEAAIPEAYCTCHNYEEVQEDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVR-- 566
            ||||.|.|.:|||..|:.:.....|..:|..|:||:|::....||.:|||:|||..|:.||::  
  Fly   520 CSEAGIEEHWCTCEPYKIISGQDWTTPIAHSVIDRMNEYFVQKNLTSLCSNLTLNYVHKTEIKTG 584

  Fly   567 --------ITESDEHVSLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYR 623
                    :.||:..|        |..||:|.||.|:|.|||:|...|:..|:|||.|||.|.|:
  Fly   585 LNIDWHQTLMESETAV--------YRIKFKVKQNSADFQATVVYHNSTQNAQVNVEKISRTNSYK 641

  Fly   624 PDASCLDDNIQKLFCICLSKL 644
            .|::|:||.:.||:|||.|.|
  Fly   642 EDSTCIDDKLAKLYCICFSDL 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 273/493 (55%)
ALP_like 207..489 CDD:293745 183/282 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914762
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.