DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG9525

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster

Alignment Length:675 Identity:215/676 (32%)
Similarity:349/676 (52%) Gaps:89/676 (13%)


  Fly    22 ILFLLIVWKITSYGVNDVLTIKYNENQKRFYVNSSNCQMAYV-EPFNAEFTKLYTPKNFTRCSNQ 85
            ::|::.::.|:...::.....::|:.|...|:.:|.|.:.|: :|...|  |....|..|.||..
  Fly     7 LIFIIAIFLISHLSLSKKRNSQFNQVQHEHYIKTSECHIPYINKPLENE--KGNIKKQHTICSKD 69

  Fly    86 SDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNK------FACFYQN-------------ITY-- 129
            ..|:.:.||....||:|:|::.|.....:|...|      :.|.|:.             :.|  
  Fly    70 ESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRDYIVDAPVVYVC 134

  Fly   130 ---GQSADHYDR----MGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQEDAFSFVQYQKT-SP 186
               .:|....|:    :|::.||.:.|:||.:|:||...||: :....||.|.|..||..|| :|
  Fly   135 YLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRN-ELAEDLQSDTFVLVQPPKTYAP 198

  Fly   187 NLDIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSP 251
            .:...|..:|::.|.|.:|:.|.||..|:||..||...|:.|.||..:.:||..|:.:.||||||
  Fly   199 LISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGYTGIGENTQSNLMASLTGYSP 263

  Fly   252 NSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLL 316
            ::..|..||::..|||..:|.|||..||.|::|||.|.  .||:|:..|.|......|:|.|.. 
  Fly   264 HTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYGEG--ISNLFDSEKYGIFEGTIDFYARHK- 325

  Fly   317 DALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYV-ADRPIWGFFWSNHISHDDFSML 380
                           .:..|:.||....:.:|||.:|::|:. .:||.:|.|:.|.|::..:.. 
  Fly   326 ---------------NLQSCIDRRFNIKHNYDYCEEFLKRHANTNRPFFGVFFGNGITNRSYDN- 374

  Fly   381 SAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRE---SFLEERQPIMFIYLPPWFR 442
            :.:|.:::..:..|:|.|....:|::.||      .|:...:|   :|.:|..||::|:|||||:
  Fly   375 ARIQTELLDKVKKFKKMGILTQSIVVLFS------YPVSSVKEKKTNFSQEDLPILYIWLPPWFK 433

  Fly   443 EKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKWS------YDCPQCQSLFYELPES 501
            ...|..|:||..|..||:|.:|::.||:|::.:     ..:|.      .|||.||:||..:||:
  Fly   434 AFRPEIVQALRINSKRLTSPYDLHLTLQHLLEL-----GERWPRAVDKLVDCPTCQTLFAPVPEN 493

  Fly   502 RSCSEAAIPEAYCTCHNYEEVQEDHGTWRMAEL-----VVDRINQFLQYHNLQNLCSSLTLKLVN 561
            |:||:|.|.|:.|.|.:|:.:..:    :|.:|     :|..||:||.:|||..||.:||||.|.
  Fly   494 RTCSDAGIGESQCPCDSYKLLSSN----QMKQLSVGKQIVRSINEFLNHHNLHELCHNLTLKSVK 554

  Fly   562 ITEVRITESDEHVSLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQ-INVELISRINIYRPD 625
            :.   :...|..:|.|...|.|   |..:.|.|||..|:.|....:||: ||||.|:|:|.|:.|
  Fly   555 MV---LQRKDRKLSSGSTYRAY---FSANPNNAEFSTTIRYANNRQELEYINVESINRLNNYQND 613

  Fly   626 ASCLDDNIQKLFCICLSKLRNNEST 650
            :||:.....:.||||.|::..|.||
  Fly   614 SSCMRRLRGRKFCICKSQILENHST 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG9525NP_609260.1 DUF229 66..554 CDD:281053 169/523 (32%)
ALP_like 206..466 CDD:293745 95/285 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4915069
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.