DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG3123

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_608716.1 Gene:CG3123 FlyBaseID:FBgn0031465 Length:634 Species:Drosophila melanogaster

Alignment Length:667 Identity:166/668 (25%)
Similarity:288/668 (43%) Gaps:90/668 (13%)


  Fly    20 IFILFLLIVWKITS-------YGVNDVLTIKYNENQKRFYVNSSNCQMAYVEPFNAEFTKLYTPK 77
            ||:|.:|....:||       ..:.:|..|..||..:.| ||::.|:::..:|.:........|.
  Fly    13 IFLLAVLCYLILTSLSDRNKTISIREVPQIYINEEDELF-VNTTGCRISATKPLSLYALSFMEPI 76

  Fly    78 NFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQS---KSNKFACFYQNITYGQSADH---- 135
            ....|..:..:|......  :.|       ::..:|:.   ...:.:|.|:.......|.:    
  Fly    77 EPVLCRMEQLMVAETIGD--RNY-------LVRNISRHGILSWRQVSCIYREFVRVDDAHNKYIS 132

  Fly   136 --YDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQEDAFSFVQYQKTSPNLDID---RKAS 195
              :.::..:|::..   |...:|.:...|.. |..||:..|...|:.....:.|...:   ||.|
  Fly   133 LKFFKLTDRTRYLE---VGTGLQHIRTWCWV-DFGRIIFHDVMYFLPPLPQATNRSTEHQKRKLS 193

  Fly   196 VIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQICD 260
            |::.|:|::|..:..|....|..|::.....|..|||:||.|||||:..:::|.|.:.       
  Fly   194 VMILGVDSISHMHYMRYFHRVADFIEHLPHTEFWGYNRVALNTYPNLIPLVSGLSVSE------- 251

  Fly   261 TTQPGC------LDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDAL 319
             .:..|      .||..|:|.:.|:.||.|.:||||..:.:|.|.|.||..:|||.|.|||:..:
  Fly   252 -MEASCYHDELNFDKCNFLWNEFKRAGYSTIFAEDTDTAGLFIYRKRGFQKQPTDIYMRPLMTEI 315

  Fly   320 EKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQF---MQRYVADRPIWGFFWSNHISHDDFSMLS 381
            |..::.......|   |.|.||...:.:|:..:.   |:|.:    .:.|.|:.|..||.|....
  Fly   316 ESHSLYRTTFDLK---CTGHRLYGEFYYDFVSKLIPHMERQL----FFSFLWNMHGIHDVFPYAK 373

  Fly   382 AMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYP 446
            .:....:..|....:.|..|:|:::|..|||.||....||.....|..||::....|.|.:.::|
  Fly   374 FVDKDYLSILTRLHEKGVMENTLILFMGDHGLRFDKFARTAPGQHEMSQPLLIAIYPEWLKRRFP 438

  Fly   447 RYVEALAQNQNRLSSNFDIYNTLKHIINIEGL----VEDTKWSYDCPQCQSLFYELPESRSCSEA 507
            ..:....:|...|.:.||::.|||.:|:::.|    |.:........:..|||..:|::|:|..|
  Fly   439 LAMSNFERNARSLITTFDLHETLKDVIHLDRLTDANVRNRTLYLTNERGISLFLPIPQNRNCKTA 503

  Fly   508 AIPEAYCTCHNYEEVQ-EDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESD 571
            .|.:.||.|:..:.|. .:......|...|||||:.::.:   ..|..|:|:.|. |..|...|.
  Fly   504 EIKQHYCLCNELKSVSTHESAIQEAASFAVDRINELIKPY---PQCRVLSLQSVR-TAYRAKSST 564

  Fly   572 EHVSLGKGLRHYHTKFQVHQNL---------AEFFATVLYDRKTEELQINVEL---ISRINIYRP 624
                       |...::|.|.:         ..|.||||......| :.:::|   ::|.:.|..
  Fly   565 -----------YRGNYRVSQVMVRLKTTPGDGNFDATVLITMLNGE-KTDMKLGGPVTRTDRYAH 617

  Fly   625 DASCLDDNIQKLFCICL 641
            .|.|:.:...:::|.||
  Fly   618 QAYCVQNYRIEMYCYCL 634

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG3123NP_608716.1 DUF229 74..555 CDD:281053 131/512 (26%)
ALP_like 192..468 CDD:293745 87/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49607
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.