DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG32985

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_788013.2 Gene:CG32985 FlyBaseID:FBgn0052985 Length:644 Species:Drosophila melanogaster

Alignment Length:637 Identity:457/638 (72%)
Similarity:537/638 (84%) Gaps:3/638 (0%)


  Fly    10 SVSYKKCILCIFILFLLIVWKITSYGVNDVLTIK-YNENQKRFYVNSSNCQMAYVEPFNAEFTKL 73
            |.|:|:.|:....:.|:.:|.:.|..|::..:.: ..|.:|.|||.|..|:|.||.||||||.|:
  Fly     6 SYSFKRLIVSFLAVTLICLWSMNSSRVDENFSARDSQEVEKLFYVESGKCKMRYVNPFNAEFLKI 70

  Fly    74 YTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNITYGQSADHYDR 138
            ..||.|..|:|:|||::||:|.||.|||||.:|||||:||:||:|.||||||.|.|||||:|||.
  Fly    71 NHPKAFIPCTNESDLISVHYDKILNQYVLHTNEEVLHELSESKTNDFACFYQKIIYGQSAEHYDG 135

  Fly   139 MGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQEDAFSFVQYQKTSPNLDIDRKASVIMYGIDT 203
            .|.|||.:.:::|||:|:|||||||:.||.|:||.|||.||||:....|:...:|||||||||||
  Fly   136 KGVKTKISQNHLVPLDVEGMLVECRTADEMRVLQRDAFVFVQYKDPPQNVKPVKKASVIMYGIDT 200

  Fly   204 VSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQICDTTQPGCLD 268
            ||||||||:||:||.|||||||||||||||||||::||||::|||:||.||:.|||:|...||||
  Fly   201 VSRTNLRRMMPMVFEFLKSPGWYEMMGYNKVADNSFPNIFAMLTGFSPESAETQICNTDVDGCLD 265

  Fly   269 KIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKM 333
            ||||||||.||:|||||||||...||.|||.||||..:||||||||.|.|||.||...|||||.|
  Fly   266 KIPFIWKDFKKDGYLTAYAEDEEHSNTFNYAKPGFAVKPTDYYFRPFLTALENETFIQYCPGCVM 330

  Fly   334 VYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDG 398
            .||||||||:|||||||||||||:||||||||.||:||.||||..|||||||||:.|||:|||||
  Fly   331 KYCLGRRLASSYIFDYCRQFMQRFVADRPIWGMFWTNHYSHDDLFMLSAMQHKILEDLLSFEKDG 395

  Fly   399 SFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNF 463
            .|||||||||||||:||||||.|:|:|||||.|:||||||||||:||||||||||||||||||||
  Fly   396 VFEHTIMIFFSDHGARFGPLMYTKEAFLEERLPMMFIYLPPWFRKKYPRYVEALAQNQNRLSSNF 460

  Fly   464 DIYNTLKHIINIEGLVEDTKWSYDCPQCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHGT 528
            |:|||||||||||||||||||||||||||||||.||||||||||||||||||||||||::||.||
  Fly   461 DLYNTLKHIINIEGLVEDTKWSYDCPQCQSLFYPLPESRSCSEAAIPEAYCTCHNYEEIKEDQGT 525

  Fly   529 WRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNL 593
            ||:|.|||||:|::|.|||||||||:|||:::|.||||:.:.|  |.|..|:|||||||||||||
  Fly   526 WRLANLVVDRMNKYLHYHNLQNLCSNLTLRVINSTEVRMDDKD--VDLANGMRHYHTKFQVHQNL 588

  Fly   594 AEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKLFCICLSKLR 645
            ||||||||||::|||||:|||||||.|:|..|:.|:::.||||:|:||||||
  Fly   589 AEFFATVLYDKQTEELQMNVELISRTNMYGTDSECVNNKIQKLYCVCLSKLR 640



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914748
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.