DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and CG31933

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_722734.1 Gene:CG31933 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster

Alignment Length:730 Identity:178/731 (24%)
Similarity:301/731 (41%) Gaps:164/731 (22%)


  Fly    12 SYKKCILCI----FILFLLIVWKITSYGVNDVLTIKYNENQKRFYVNSSNCQMAYVEPFNAEFTK 72
            |::|.:|.:    .||:.|:......|.....:       ...|:||:..|::..::..|....|
  Fly     5 SFRKLVLGVILTTIILYALLFLDTQCYETGGKI-------HNAFFVNTDGCRIIAMDVMNPTIAK 62

  Fly    73 LYT------PKNFTRCSNQSDL------------VTVHFDSILKQYVLHVDEEVLHKLSQSKSNK 119
             ||      .:.:.:|.:|:..            :|...|.||::..|..|.::           
  Fly    63 -YTDWEWKDKRFYLKCPHQTWFRTEVANGDWYLKLTRDIDRILQESDLTHDWQI----------- 115

  Fly   120 FACFYQNI---------TYGQSADHYDRMGKKTKFTHDY----VVPLNVQGMLVECRSGDEKRIL 171
             .|::..|         .||           .|.|..:|    .||..::.|.|:|.:....:.|
  Fly   116 -KCYWFRIKIKGRWRAKIYG-----------PTMFPLEYPYALKVPKGLRHMRVKCLNTFTNKTL 168

  Fly   172 QEDAFSFVQ------YQK-----------------TSPNLDIDRKASVIMYGIDTVSRTNLRRLM 213
            .:||..|:|      .:|                 |||       .||::.|:|:||..||.|.|
  Fly   169 HDDAHFFIQPPPEKLLKKPPATLKYWDGEKHSSGATSP-------ISVMILGLDSVSHLNLLRQM 226

  Fly   214 PVVFGFLK-SPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQICDTTQPGCLDKIPFIWKDM 277
            |....::: :....|..|:||:..|||||:.::|||.|  :|:::.....|. |:|.:|.|||:.
  Fly   227 PRTVRYMRQNMSQVEFWGFNKIGTNTYPNLIALLTGLS--AAESEAYWVRQK-CMDNLPLIWKEF 288

  Fly   278 KKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLA 342
            |:.||.|::|||....::|.:.||||....||   ..|.|.:....|..........:|:|.|..
  Fly   289 KRAGYNTSFAEDMAIYSMFYFGKPGFKRPTTD---NNLHDFMVDLYINRQASSVSDTHCMGERAF 350

  Fly   343 NSYIFDYCRQFM---QRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTI 404
            ...:.:...:.:   |||    |.:.|:|..:..|:.|:.......:....|.:.:..|...:||
  Fly   351 MDILLEMNDRLLPHTQRY----PFFSFYWWANGFHEFFNSPRLADGRFERLLRSLDDAGITNNTI 411

  Fly   405 MIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTL 469
            :.|.||||.|:|....:.:..:|:.||.:.:..|.|.|.|||..:::|..|.:.|.:.:|::.||
  Fly   412 IFFMSDHGLRWGLFRSSFQGMIEDSQPFLSVLYPKWMRLKYPMAIKSLVGNAHSLVTTYDLHETL 476

  Fly   470 KHIINIEGLVEDTK--------WSY---DCPQCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQ 523
            |||:....| |||.        |..   ..|:..|||..:|..|:|:.:.||..:|.||....:.
  Fly   477 KHILEPSSL-EDTSITQKTEELWKLKGSQTPRAVSLFLPIPPWRNCNTSHIPSKFCLCHKQIPIP 540

  Fly   524 EDHG-TWRMAELVVDRINQFL-QYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTK 586
            |.:. ..:.|.:::|.:||.: :|    .:|..|.|..:........:.|:...:.||       
  Fly   541 ESNRVVTKSASIIIDYVNQLMVEY----PVCIPLQLDSIESAYFAAPQRDDDFYIEKG------- 594

  Fly   587 FQVHQNLAEFFATVLYDRKTEELQINVELISRI-NIY-----RPDAS------------------ 627
               |:|:..........:|.|:..|.|.|.::. |.|     |...|                  
  Fly   595 ---HKNVYPEKGPFWKKQKYEDRDIVVRLKTKPGNAYFEGMTRRQGSKLSLVGEVVRVGGEGNRN 656

  Fly   628 --CLDDNIQKLFCIC 640
              |:|:.:.:.||.|
  Fly   657 NDCIDNPLLEPFCHC 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
CG31933NP_722734.1 DUF229 114..576 CDD:281053 136/507 (27%)
ALP_like 208..483 CDD:293745 89/285 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49634
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.