DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and T23E1.1

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001343691.1 Gene:T23E1.1 WormBaseID:WBGene00020728 Length:603 Species:Caenorhabditis elegans

Alignment Length:642 Identity:138/643 (21%)
Similarity:237/643 (37%) Gaps:165/643 (26%)


  Fly    20 IFILFLLIVW-KITSYGV----NDVLTIKYNENQKRFY-------VNSSNCQMAYVEPFNAEFTK 72
            |.|:|.:..| :|::|.|    .:..:::...|.|.|.       .|.::|....|....|:...
 Worm    11 ISIIFCIGFWIQISNYRVRAHRREFESVEPFNNFKFFNEIGQVEDENENSCYPYMVHSIEADILG 75

  Fly    73 LYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNITYGQSADHYD 137
            |.:|..|: |::.........|.||.     :.|.:..|....::..|.|.|..|.         
 Worm    76 LISPMIFS-CNSPMGNWANFSDGILT-----ISERIFEKRKAEQNQNFTCVYAEIV--------- 125

  Fly   138 RMGKKTKFTHDYV--------------VPLNVQG--MLVECRSGDEKRILQEDAFSFVQYQKTSP 186
               .||:..:..:              :|..::.  .:|.||.........:..|:|:...:|..
 Worm   126 ---PKTELPNGTILAEASKLETPIEPGIPTKIESEQFVVFCRDPFGNHFYNKTFFNFLPRSETLT 187

  Fly   187 NLDIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSP 251
            ||. ....|:::..|..:|.....|.:.....|              .|||.:.: ||:....|.
 Worm   188 NLS-SSDESLMILSISGMSHNQAMRHLKRSLKF--------------AADNEFQS-FSMFNQRSQ 236

  Fly   252 NSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDT-VFSNIFNYMKPGFLSRPTDYYFRPL 315
            ::.:|.:   ...|..:|   :|...|.||..|....|: .||.::.|.        .||:.. |
 Worm   237 DNLENSL---KTFGGSEK---VWNIAKNNGCPTFLNTDSPKFSKMYGYQ--------FDYHSN-L 286

  Fly   316 LDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADR-PIW-GFFWSNHISHDDFS 378
            ..:..|:             .||:       .|.|.......|.|. .:| .|..:.|.:...||
 Worm   287 YSSFNKQ-------------YLGQ-------VDNCISDGSVTVEDAITLWTNFSLTFHPNLCHFS 331

  Fly   379 MLSAMQ------HKIVG--DLLN-----FEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQ 430
            :|...:      .|||.  ::||     .:..|...:|.::..||.|:....:..|....||.|.
 Worm   332 LLHFTEVAGPGDGKIVNIDEVLNNSLEILQSFGVLHNTTVVILSDGGTGNSTIFETETGKLESRY 396

  Fly   431 PIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKWSYDCPQCQSLF 495
            .:..|.|...:|:::|...|.|.:|.:||.:|.|:..||||||            ||..|....|
 Worm   397 GVFLIRLSDSYRKRFPENAEILKKNVDRLITNQDVAETLKHII------------YDQNQENVTF 449

  Fly   496 ------YELPESRSCSEAAIPEAYCTCHNYEEVQEDHGTWRMAELVVDRINQFLQYHNLQNLCSS 554
                  .|..:||||..|.|.:.:|.|.            ::|::.:|:..:.     |:||   
 Worm   450 ENSLLSRENSKSRSCDIAGIEDEFCICS------------KLAQIGIDKRPEI-----LRNL--- 494

  Fly   555 LTLKLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNLA--EFF-----ATVLYDR 604
              ||:     |:...|.:...|...:...:.||::::::.  :||     |||..::
 Worm   495 --LKI-----VKHEFSGQKCILNIEIDSENLKFRIYRSITFFKFFGFLTTATVKLEK 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
T23E1.1NP_001343691.1 DUF229 108..500 CDD:308570 107/494 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.