DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and T07G12.3

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_501945.2 Gene:T07G12.3 WormBaseID:WBGene00011594 Length:623 Species:Caenorhabditis elegans

Alignment Length:711 Identity:162/712 (23%)
Similarity:266/712 (37%) Gaps:187/712 (26%)


  Fly    11 VSYKKCILCIFILFLLIVWKITSYGVNDVLTIKYNENQKRFYVNSS------------------- 56
            :.|...||..|:.|.::.|:..:.|...:       ..|..|::||                   
 Worm     4 IKYIITILLAFLGFYMLSWRSFNNGSTKI-------ESKFLYLDSSRSAHNICALPIYDYWDTSI 61

  Fly    57 -----------NCQMAYV---EPFNAEFTKLYTPKN-FTRC-SNQSDLVTVHFDSILKQYVLHVD 105
                       ||...||   |..|:.:..:....| ..|| |.......|.....:|..  |||
 Worm    62 KNVMHEYNPARNCYKNYVQWTELVNSTWRIVKDGANCLARCFSGIGGSKNVKIGPWMKPG--HVD 124

  Fly   106 EEVLHKLSQSKSNKFACFYQNI-TYGQSADHYDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEKR 169
            .|.|..:         |:..|| .||.              .|..::|                 
 Worm   125 CEFLETV---------CWEDNIEVYGH--------------IHTQIIP----------------- 149

  Fly   170 ILQEDAFSFVQYQKTSPNLDIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGY--- 231
                        :|.||....| ..:|.::.||.::....:|..|.:..:.|:.  ::|:.:   
 Worm   150 ------------RKASPTKFKD-APNVFIFTIDAMNTGMAKRSFPKLLSYFKNE--FQMIEFPFV 199

  Fly   232 NKVADNTYPNIFSILTGYSPNSAK-------------NQICDTTQPGCLDKIPFIWKDMKKNGYL 283
            |||.:|:.||...:..|.|....:             ||.|:|    .||....|:||.|.:||.
 Worm   200 NKVGENSRPNGLPLWFGKSIEGGRRVTGDDVEVDWDWNQYCET----YLDNSSHIFKDFKDHGYA 260

  Fly   284 TAYAEDTVFSNIFNYMKP--GFLSRPTDYYFRPLLDALE---KETIKLYCPGCKMVYCLGRRLAN 343
            |...||.. .|:.:....  ||...|||:.|||.....|   .|..|.:..|   .:|   |..:
 Worm   261 TMLFEDWE-GNVVDSWPTCVGFEEPPTDHTFRPFASVSETHGMEITKRHLSG---KFC---RETH 318

  Fly   344 SYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEK-DGSFEHTIMIF 407
            ..|.:...|.::.| .||||:.:.|...::||.....:.:...:|.   .|:| :..|:::.::|
 Worm   319 HAIMELLEQGIEAY-KDRPIFSWLWLAWVAHDWIDGAARVDEYLVN---YFKKHNNMFDNSFVMF 379

  Fly   408 FSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHI 472
            .||||.|.|..|||.....|...|.:.|.:|..||......:|.|..:..:|.::||:..||..|
 Worm   380 VSDHGLRTGKHMRTEIGAFERDNPFLSISIPKRFRATKFGILETLNFDSKQLQTHFDVRATLLDI 444

  Fly   473 INIEGL----------VEDTKWSYDCPQCQSLFYELPE-SRSCSEAAIPEAYCTC-------HNY 519
            :..:..          :.|.|.       .||..:.|: .|:|:...||:.:|.|       || 
 Worm   445 LKFQPTSKFMDRQQKNIPDEKG-------HSLIRKQPDFPRTCATLPIPQQWCICQVDKFEIHN- 501

  Fly   520 EEVQEDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLG--KGLRH 582
             |..::|    :.|.:::.:::.|:..|:..:|.  |.:|..:|.:        :..|  :.:|.
 Worm   502 -ETLKNH----LGEKLLNHVHRKLKKLNVSEICE--TFRLSKVTSL--------IEYGYVRTMRT 551

  Fly   583 YHTKFQVHQNL---AEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKLFCIC 640
            |  |..|...:   |.|...|.||.:|:..:.  |.::|::.|.....|.....|...|.|
 Worm   552 Y--KISVETTISSYAHFETFVTYDIETDIAKF--EKVTRLDNYAMTTDCTKPIRQSPLCYC 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
T07G12.3NP_501945.2 DUF229 67..538 CDD:281053 132/558 (24%)
ALP_like 161..448 CDD:293745 83/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.