DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and R03G8.1

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_510172.2 Gene:R03G8.1 WormBaseID:WBGene00010996 Length:663 Species:Caenorhabditis elegans

Alignment Length:698 Identity:158/699 (23%)
Similarity:265/699 (38%) Gaps:147/699 (21%)


  Fly    21 FILFLLIVWKITSYGVNDVLTIKY----NENQKRFYVNSS--NCQMAYVEPFNAEFTKLYTPKNF 79
            :||::|:....| |.|:.|:...|    .|:   ..|.:|  .|::...:.::.|......|   
 Worm    16 WILYILVCIAFT-YSVSIVIHTDYAAPVTED---ILVGNSWDTCELPRYDVWDEELFGYLNP--- 73

  Fly    80 TRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNIT-----YGQSADHYDRM 139
                |::.|...  |:..|.         |.||..||..  ..|..|:|     :.:..|..:.:
 Worm    74 ----NENPLKKC--DTSFKP---------LTKLENSKWG--VTFAHNLTCRARCHTRKRDKENLV 121

  Fly   140 GKKTKFTHDYVVPLNVQGMLVE---CRSGDEKRILQEDAFSFVQYQ--KTSP-----NLDIDRKA 194
            |..|      ..|..:...::|   ...|.|:|    |.:.::..|  .|.|     |.|: ::.
 Worm   122 GNWT------YTPGKINCEILETVCAEKGGEQR----DVYGYLHSQIIPTKPKLSRTNADL-KEY 175

  Fly   195 SVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMG-----YNKVADNTYPNIFSILTGYSPNSA 254
            .|.:..:|::|.:...|.:|....|.||    .|.|     .|||.||:.||..::..|......
 Worm   176 DVFVILLDSLSYSQAARSLPRTVSFFKS----YMKGIIFPYMNKVGDNSRPNGVALWFGKLLEKV 236

  Fly   255 KNQICD--------TTQPGC---LDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPT 308
            ...|.|        |....|   .|....::.:.|.:||.|..|||.....:......|:.::..
 Worm   237 DRFIFDKPSLEADWTDDYFCNVFKDNETSLFDEFKTHGYKTLMAEDWALGTLIWPNCLGYRNQSI 301

  Fly   309 DYYFRPLLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVA-------------- 359
            |:|.||...|.||....:.........|   |..::.:.||..||:..|..              
 Worm   302 DHYMRPFQLAHEKYGTPVTREHLNGSLC---REDHNTLLDYLAQFLDAYSGSNDSIQLKREKSPN 363

  Fly   360 --DRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNF--EKDGSFEHTIMIFFSDHGSRFGPLMR 420
              |:..:.|.|:..:.|...:...|.::....|.|||  :.....|.:.::...|||.|.|.:..
 Worm   364 SPDQRKFAFLWTTRLGHATENGFDATENGSDNDFLNFFIKHRKKLEDSFVLLLGDHGFRLGGVRN 428

  Fly   421 TRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKWS 485
            |....::...|:..|.:|...|.. ...::.|..|..:|.::||...|:..|:..:   ...|:|
 Worm   429 TAVGAIDVNNPLTAISVPNSLRTN-TDILKILNMNSEKLQTHFDTRATILDILKFQ---PAEKFS 489

  Fly   486 YDCP------QCQS-LFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHGTWRM--AELVVDRINQ 541
            ...|      :.|| |..:.|.:|:|....||..||.|...:.....:.|..|  .|.|.:.:|:
 Worm   490 AITPLQIPGEKGQSHLRNQPPFNRNCQTMPIPFEYCICQFNKTSVPINSTISMEIGEKVAENVNK 554

  Fly   542 FLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTKF----------QVHQ-NLAE 595
            .||.:|..:.|.|:..:.        |||         |..|:.|.          |:.: :.|:
 Worm   555 LLQINNFTSECISMVFER--------TES---------LLQYNQKLGNSTIYTVIAQMKKPSEAK 602

  Fly   596 FFATVLYDRKTEELQINVELIS---RINIYRPDASCLDDNIQKLFCIC 640
            |.|||   :.||.   |::::|   |::.|...|.|::....:..|.|
 Worm   603 FKATV---KITEG---NIKIVSKVERVDSYGKTADCIESETHRPICYC 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
R03G8.1NP_510172.2 DUF229 74..651 CDD:281053 144/630 (23%)
ALP_like 175..483 CDD:293745 72/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50157
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.