DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and M03F8.5

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_504546.2 Gene:M03F8.5 WormBaseID:WBGene00019764 Length:417 Species:Caenorhabditis elegans

Alignment Length:450 Identity:98/450 (22%)
Similarity:177/450 (39%) Gaps:88/450 (20%)


  Fly     2 MLKMKTFTSVSYKKCILCIFILFLLIVWKITSYGVNDVLTIK-YNENQKRFYVNSSNCQMAYVEP 65
            ||:.:|.:::.....|..:..||.::.....::..|..|..: ::|..::.::..:.|:.|:.:|
 Worm     1 MLRRRTISALIQIVLITSLICLFYIVSQSHLNFKPNLKLEFRNFSEPHRQAHLFDNYCKFAWTDP 65

  Fly    66 FNAEFTK-LYTPKNFTRCSNQSDL-----VTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFY 124
            .::...| |..||:.:......||     .|..|...||.|                .|...|..
 Worm    66 MDSTLKKRLKFPKHASCEKYNIDLFKRYPATGEFSMKLKSY----------------KNNLECVA 114

  Fly   125 QNITYGQSAD-HYDRMGKKTKFTHDYVVP-------LNVQGMLVECRSGDEKRILQEDAFSFVQY 181
            |.:..|...: |..::|:...|:     |       :|....|:.|.|  ::.::....|..:..
 Worm   115 QVLKGGLRPEAHTFKLGRTQNFS-----PKLNKRFWINADNFLITCFS--KQLVIYRKQFMGLNM 172

  Fly   182 QKTSPNLDID-----------------RKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMM 229
            |:..| |.:|                 .:.|:.:.|:|:.||....|.|....|.|...|.....
 Worm   173 QEKLP-LVVDGSFVIPEPDYTFHGEKSTRFSISILGLDSTSRAQFGRNMKKTSGLLDRLGSVVFN 236

  Fly   230 GYNKVADNTYPNIFSILTGYSPNSAK------------NQICDTTQPGCLDKIPFIWKDMKKNGY 282
            .||||.||:..|:..|.......:..            |:|..:..|...|.|.:|||.:... |
 Worm   237 AYNKVGDNSAVNMLPIFANELQETESMSLIDETGDVNINKILPSKTPLNPDTIQWIWKQLPPE-Y 300

  Fly   283 LTAYAEDTVFSN--IFNY----MKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCL-GRR 340
            :|.|.:|.:.::  :|:|    ...||...|..:|:||..:.|..:....:..      || |:.
 Worm   301 ITMYNDDIMHTSRGLFHYPPDNFLGGFSKPPAKFYYRPYYNHLYTQMNNWWRK------CLDGQL 359

  Fly   341 LANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDL----LNFEK 396
            ||..:|..:.|  .:|.....|.:||.:.:.::|||.:.|:.:.:.:...|    |.|:|
 Worm   360 LAEVFIDSWFR--FERVFGKLPHFGFTFISSLTHDDPNNLNLLDNTLYHRLEYLNLIFKK 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
M03F8.5NP_504546.2 ALP_like 201..>391 CDD:304875 50/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49813
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.