DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and K03A11.4

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_510170.2 Gene:K03A11.4 WormBaseID:WBGene00010521 Length:664 Species:Caenorhabditis elegans

Alignment Length:740 Identity:150/741 (20%)
Similarity:263/741 (35%) Gaps:203/741 (27%)


  Fly     5 MKTFTSVSY-----KKCILCIFILFLLIVWKIT-----SYG---------------VNDVLTI-- 42
            :|...:||:     ..|::..|:...:..:..:     |||               |.:.|||  
 Worm     9 LKKMQNVSWGALAVSGCMIVYFVFLGIASYSPSMIPENSYGFYQAIVGNLSEKYQYVENKLTIGE 73

  Fly    43 ---------KYN--ENQKRFYVNSS-----NCQMAYVEPF----NAEFTKLYTPKNF---TRCSN 84
                     ||:  :.:...|||.:     ||..::| ||    |:.:..:.|.||.   .||..
 Worm    74 DPWDKCVLPKYDVWDEEVMPYVNPNKNPLKNCDTSFV-PFTALQNSSWKIVNTNKNLECRARCHT 137

  Fly    85 QSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNITYGQSADHYDRMGKKTKFTHDY 149
            :......|....::. ...||.|.|         :.||         |.::.|..|    :.|..
 Worm   138 RKSDRRNHIGEWMRT-PGPVDCEFL---------EAAC---------SENNQDVYG----YLHSQ 179

  Fly   150 VVPLNVQGMLVECRSGDEKRILQEDAFSFVQYQKTSPNLDIDRKASVIMYGIDTVSRTNLRRLMP 214
            |:|...    :|..:.|...::|.|.|                   ||:  :|::|.:..||.:|
 Worm   180 VIPKPP----IEKPTIDISSLMQFDVF-------------------VIL--LDSLSYSQGRRALP 219

  Fly   215 ------------VVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYS---------------PN 252
                        |:|.::           |||.:|:.||...|..|.|               |:
 Worm   220 RTLSYFTNHMDGVIFPYV-----------NKVGENSRPNGIPIWFGKSLEKIDKTLLDEKVIPPD 273

  Fly   253 SAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMK-PGFLSRPTDYYFRPLL 316
            ......|.|.:    |....::.:....||.|..|||.. ....|:.. .||.:.|.|::.||..
 Worm   274 WPHKYFCKTYK----DNETSLFSEFHDYGYRTLLAEDWA-DGTMNWPNCVGFENPPIDHFMRPFQ 333

  Fly   317 DALEKETIKLYCPGCKMVYCLGR--RLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSM 379
            :|.|:   |.:.......:..|:  |..:..:.||..||.:.| .|:..:|:.|:..:.|:..:.
 Worm   334 NAYER---KNHGTSLTQKHLNGKLCRETHHTLLDYMGQFTKAY-PDQRKFGWVWAIDLGHNTENG 394

  Fly   380 LSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREK 444
            .:.........|:...|  :.:.:.:....|||.|||.:.:|....|:...|...:.:|...| |
 Worm   395 FAHADKDFHNYLIKHRK--ALDESFVFILGDHGLRFGDVRKTFVGSLDVNNPFTALSIPKVLR-K 456

  Fly   445 YPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKWSYDCPQCQSLFYELP---------- 499
            ..:.:|.:.:|..::.|::|...|:..|:..:..   ..:|...|:      |:|          
 Worm   457 TTKILEIMTENAKQIQSHYDTRATILDIMKYQSA---NSFSETMPR------EIPGEKGSSYIRK 512

  Fly   500 ---ESRSCSEAAIPEAYCTCHNYEEVQEDHGTW---RMAELVVDRINQFLQYHNLQNLCSSLTLK 558
               ..|:|....:|..||.| .:::.:....|.   .:.:.:...:|..:...|...:|..:   
 Worm   513 QPSTPRNCRNMPVPLQYCIC-QFKKSKLPRNTTTAESIGKALATAVNTQIAEANFTKMCIKM--- 573

  Fly   559 LVNITEVRITESDEHVSL------GKGLRHYH-TKFQVHQNLAEFFATVLYDRKTEELQINV-EL 615
                      |.::..||      .||...|. |......:.|||...|    |....:|.| .:
 Worm   574 ----------EWEKTTSLLAYDDKFKGATLYSVTAVMKEPSNAEFKGNV----KIMNGEIKVLGM 624

  Fly   616 ISRINIYRPDASCLDDNIQKLFCIC 640
            :.|.|.|...|.|:.....:.:|.|
 Worm   625 VERSNKYGKTADCMKSEHHRPYCYC 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
K03A11.4NP_510170.2 DUF229 98..570 CDD:281053 111/554 (20%)
ALP_like 199..488 CDD:293745 71/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.