DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and F32G8.2

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_505706.3 Gene:F32G8.2 WormBaseID:WBGene00009338 Length:561 Species:Caenorhabditis elegans

Alignment Length:697 Identity:121/698 (17%)
Similarity:230/698 (33%) Gaps:239/698 (34%)


  Fly     4 KMKTFTSVSYKKCILCIFILFLLIVWKITSYGVNDVLTIKY------NENQKR----------FY 52
            ::|.|.|:.: ..:.|:.|:|::.:....:|..|.....||      .:.:::          |:
 Worm     8 QVKIFPSLIF-AILSCLLIIFIVGITHKANYNTNVGFEKKYEYAYTMQDTREQLGNFCKFPFLFF 71

  Fly    53 VNSSNCQMAY-VEP--------------FNAEFTKLYTPKNFT-------RCSNQSDLVTVHFDS 95
            .|.......| |:|              |:......|.|:..|       ||:.|::      :.
 Worm    72 ANYDVEDGIYNVDPEDDCVPDELNKYVNFSTTSVLTYRPQPITNLSLEPIRCAYQTN------NG 130

  Fly    96 ILKQYV---LHVDEEVLHK--LSQSKSNKFACFYQNITYGQSADHYDRMGKKTKFTHDYVVPLNV 155
            :.||:.   .:|..::.|.  |...|.|:...|.:                  .|.:..|:|..|
 Worm   131 LSKQFFEIEPNVPIQIPHYNFLVSCKRNEKEVFVK------------------PFVNFGVIPKEV 177

  Fly   156 QG-------------MLVECRSGDEKRILQEDAFSFVQ---YQKTSPNLDIDRKASVIMYGIDTV 204
            .|             ||...:....|.::|::.|.|.|   .::|.|.||:     ::..||.: 
 Worm   178 PGESVAVILLPSINHMLFTKKIIRTKTVMQKNGFKFAQMLNMKETKPFLDL-----LLELGISS- 236

  Fly   205 SRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQICDTTQPGCLDK 269
                                  |:..:.:...:.:...||     .|...:            :.
 Worm   237 ----------------------EISVFQQAKKHNFTTFFS-----GPQQIR------------EL 262

  Fly   270 IPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMV 334
            |...:..|:...|::....|..|.     ::.|          |.|:|. :.|.::|:.      
 Worm   263 IDVDYDTMEHRNYISNNLIDENFC-----LQDG----------RKLMDD-QLENMELFL------ 305

  Fly   335 YCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDGS 399
                ...:.|..|  ...|:..|.:.:.:..|..||        |.:.:|.|           |.
 Worm   306 ----ESTSESKFF--ALMFLDDYGSQKSLIDFDLSN--------MFTRLQQK-----------GI 345

  Fly   400 FEHTIMIFFSDHGSRFGPLMRTRESFLEE-RQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNF 463
            |:.|..|..:.:       :..:|...|: :.|...:.|.....:.:......|..|.:||.:..
 Worm   346 FKSTTFIVTTYN-------LSAKEVTDEQSKNPFFAVRLSDTLMKSHKTESHFLHLNFHRLLTTS 403

  Fly   464 DIYNTLKHIINIEGLVEDTKWSYDCPQCQSLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHGT 528
            :.|:.:.:::       |.|.|::.    |.|.....:|||....:.:..|.|            
 Worm   404 NSYHLIMNLL-------DPKTSFNL----SPFSLQSTTRSCQSENLSDEICLC------------ 445

  Fly   529 WRMAEL-VVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYH--TKFQVH 590
              |..: |.|.||.                  |||..::..|.:    .||.::.|.  ..|:: 
 Worm   446 --MKPIPVPDFINP------------------VNINFMQKLEKE----FGKEIKMYKCVQSFEM- 485

  Fly   591 QNLAEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKLF 637
            .|...||.   ||....:::| |||.::..:.....:.:|..::|.|
 Worm   486 GNQTAFFE---YDNSKGKIRI-VELSAKARVLGKRRNIIDVPLKKTF 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
F32G8.2NP_505706.3 ALP_like <297..414 CDD:304875 25/162 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49970
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.