DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and F32D8.2

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_505771.2 Gene:F32D8.2 WormBaseID:WBGene00009327 Length:568 Species:Caenorhabditis elegans

Alignment Length:679 Identity:135/680 (20%)
Similarity:236/680 (35%) Gaps:213/680 (31%)


  Fly     1 MMLKMKTFTSVSYKKCILCIFILFLLIVWKITSYGVNDVLTIKYNENQKRFYVNSSNCQMAYVEP 65
            |...::...|:.....||.....||||...|.|:                |.:.        ::.
 Worm     1 MSFNLRKHQSILPSSMILMFLCFFLLIFSVIMSH----------------FSIE--------IKE 41

  Fly    66 FNAEFTKLYTPKNFTRCSNQSDLVTVHFDSILK-QYVL--HVDEEVLHKLSQSKSNKFACFYQNI 127
            |:.:....|.|:.........:|:|    ::.| .|:.  :.||:|. .|:..||.      |:|
 Worm    42 FDKDGGIKYKPEFVYSLVETRELLT----NVCKLPYIFFPNEDEDVF-GLTPDKSK------QHI 95

  Fly   128 TYGQ------------SADHYDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQED------ 174
            ..|:            |:|.|  :..::|.|:|  :|.:::....:....:|..|..|.      
 Worm    96 VRGECKINELNEKVDLSSDGY--LTLRSKNTND--LPSDIRCTFYKNSGPNEHPIKVEKNVPVKV 156

  Fly   175 -----AFS-----FVQYQKTSPNL-DIDRKA---SVIMYGIDTVSRTNLRRLMPVVFGFLKSPGW 225
                 ||:     .|::.|...|. .|.:|:   |:.:..:..::.....:.||:...|::    
 Worm   157 PFYNFAFACERNGIVEFLKPFVNFASIPKKSNGGSIAIIFLPAINHKLFMKKMPLSKHFMQ---- 217

  Fly   226 YEMMGYNKVADNTYPNIFSILTGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDT 290
                      ||.: .....::...|||.::.:   .|.|..:||. :::..|:|.:.|      
 Worm   218 ----------DNQF-RFAQFMSKNEPNSMQDLL---LQLGISNKIN-MFRKAKQNNFTT------ 261

  Fly   291 VFSNIFNYMKPGFLSRP--------TDYYFRPLLDALEKETI--KLYCPGCKMVYCL--GRRLAN 343
                        |.|.|        .||      |.|:.:..  :....|   ..||  |::|.|
 Worm   262 ------------FFSGPQQIRYMIDVDY------DTLDHQNFITQFLIDG---NLCLKNGKKLVN 305

  Fly   344 SYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQH-KIVGDLLNFEKDGSFEHTIMIF 407
            ..: :....|:.. .||..::...:.:  .:|::...|..|. |.:.|||  ::...||:|.:|.
 Worm   306 DQL-EKIGAFLTS-TADSKVFSAMFID--EYDEYRRQSIDQDLKKMLDLL--KESNIFENTTLII 364

  Fly   408 FSDHGSRFGPLMRTRESFLEERQPIMFIYLPP-WFREKYPRYVEALAQNQNRLSSNFDIYNTLKH 471
            .|..       :.|::...|..:..||.:.|. .|.|...:.:..:..|.|||.|:.:....|..
 Worm   365 TSYD-------LSTKDIENENDKYPMFAFRPSNQFIENNNQKLYFMNMNFNRLLSSTNFNQMLVE 422

  Fly   472 IINIEGLVEDTKWSYDCPQ---CQSLFYELPESRSCSEAAIPEAYCTCHN------YEEVQEDHG 527
            :||              |:   .:|:|...|.||:|:...|.|..|.|.|      |.|..|   
 Worm   423 LIN--------------PKEKSSKSVFIAQPTSRNCTSEGISENICLCMNMSTSSGYPEKGE--- 470

  Fly   528 TWRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQN 592
                        ..|||           ||:         |...:.|...|.:|.:        .
 Worm   471 ------------KNFLQ-----------TLR---------TRFTQEVKTHKCVRSF--------E 495

  Fly   593 LAEFFATVLYDRKTEELQINVELISRINI 621
            |.::.....|...|.:....|||...:||
 Worm   496 LEDYKIFYEYSIGTSKEVRGVELTGFVNI 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
F32D8.2NP_505771.2 DUF229 <324..463 CDD:281053 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49964
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.