DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and F15H10.7

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_505674.1 Gene:F15H10.7 WormBaseID:WBGene00008874 Length:666 Species:Caenorhabditis elegans

Alignment Length:687 Identity:164/688 (24%)
Similarity:291/688 (42%) Gaps:97/688 (14%)


  Fly    11 VSYKKCILCIFILFLLIVWKI----TSYGVND--VLTIKYNENQKRFYVNSSNCQMAYVEPFNAE 69
            ::|...:..||::...:.:.:    |.:..:.  :...|..::|.:     |.|.:...:|::..
 Worm    14 ITYYSKVALIFVICFGVYYGLFRTETDFSTHPHFLYLQKLRDSQSK-----SECVIPDADPWDPS 73

  Fly    70 FTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNITYGQSAD 134
            ....|:..:...||.........|::    .:|..:.:|:        ....|:...|.:.::..
 Worm    74 ILSYYSKPSPLVCSTMQVQAVKSFNN----GILTFEPQVI--------KNARCYKTGIRHDENVT 126

  Fly   135 HYDRMGKK---TKFTHDYVVPLNVQGMLVECRSGDEKRILQEDAFSFVQYQKTSPNLDIDRKA-- 194
            ..|.:.:|   ...||...:.::.:...:.|.|.:   :|:.:.|.:...|....:.:|..|.  
 Worm   127 DLDVIYEKPVPLNLTHTSSIKISDEVFQITCESDN---LLKSEIFKYHYTQIVPKSSNIKNKVIE 188

  Fly   195 -------SVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPN 252
                   ||||.|:|::||.|..|.|...:.::|..|:.:|.|:.|:.||||.|:.:||||....
 Worm   189 QSTSDFPSVIMIGLDSMSRGNFVRQMQKTYKYMKEAGFIDMEGHMKIHDNTYGNLLAILTGKRGV 253

  Fly   253 SAKNQICDTTQPG--CLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNY--MKPGFLSRPTDYYFR 313
            ..|....:..:..  ..|:..||||....|||.|.:|||......|.|  |..|||.:|||:|.|
 Worm   254 GVKEFSTEINESWHIAFDEFDFIWKTFSDNGYATLFAEDRPDIGTFTYKNMLEGFLKQPTDHYIR 318

  Fly   314 P-----LLDALEKETIKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHIS 373
            |     ....:.:.::         ..|......:.....|..:|:::|...|. :.|:||..:|
 Worm   319 PFWISAFWSLISRRSV---------ASCYDSTPQHKIQLKYLEEFLEKYDKKRK-FAFWWSQDMS 373

  Fly   374 HDDFSMLSAMQHKIVGDLLNFEKDGS--FEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIY 436
            |...:::.    |:..|...|.|:..  .|.:|:|.|||||.|:..:..|....:|.|.|...|.
 Worm   374 HGFLNLIG----KVDDDFEKFFKNNEKRMEDSIIIVFSDHGHRYDKIRETVIGRIESRMPFHSIR 434

  Fly   437 LPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKWSY-DCPQCQSLFYELPE 500
            :|...::|||:.||.|..|...:::.||:.::|:.|..  |.|.: ||:. |..:..|.|...|:
 Worm   435 IPDGIKKKYPQIVENLMVNSKLMTTQFDVNDSLRKIAT--GKVGE-KWTQTDRKRSYSYFDPFPK 496

  Fly   501 SRSCSEAAIPEAYCTCHNYEEVQEDHGTWRMAELVVDRI-NQFLQYHNLQN-------------- 550
            ...|.||.||..:|.|.:..|:.:........||:  || |..|:  |.:.              
 Worm   497 RIGCYEAGIPSDFCPCFSEIEIPKSEAKEAAVELM--RIVNDLLE--NTEKTEEYEPDSKELTEY 557

  Fly   551 LCSSLTLKLVNITEVRI-------TESDEHVSLGKGLRHYH--TKFQVHQNLAEFFATVLYDRKT 606
            :|:.:.::.|..:.||:       ....|...|......||  .:.:...| |...:|:.::.||
 Worm   558 MCTPMEIQNVEFSSVRLPMLSVLKDVKSEDTPLQSFSLQYHVVVRAKAPSN-ALLESTLEHNLKT 621

  Fly   607 EELQINVELISRINIYRPDASCLDDNIQKLFCICLSK 643
            .... ::..:.|.|.|...:.|::|.|.|..|.|:|:
 Worm   622 NTWS-SLGEVERNNKYGNTSFCVNDRILKKICHCISR 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
F15H10.7NP_505674.1 DUF229 79..568 CDD:281053 133/525 (25%)
ALP_like 195..472 CDD:293745 90/291 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.