DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and F07C3.3

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_505391.4 Gene:F07C3.3 WormBaseID:WBGene00017194 Length:746 Species:Caenorhabditis elegans

Alignment Length:731 Identity:164/732 (22%)
Similarity:287/732 (39%) Gaps:175/732 (24%)


  Fly    28 VWKITSYGVND----------VLTIKYNENQKRFYVNSSNCQMAYVE---PFNAEFTKLYTPKNF 79
            :|.|..:|.:|          :||....:|..:|.:.:|     |.|   ||:     |......
 Worm    66 LWNINVFGDDDNIKTEIERDPLLTHHPFDNTCKFPLPNS-----YAEDIIPFH-----LSERMRQ 120

  Fly    80 TRCS-NQSDLVTVHFDSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNITYGQSADHYDRMGKKT 143
            .:|. .|.|..|:..:..:..:...||...|.:..|.|        .:|..|........|.|.:
 Worm   121 LKCEVKQKDYATMDSEGYIYVHPHFVDWPRLERDVQCK--------VDIIEGGLRKPERNMTKNS 177

  Fly   144 KFTHDYV-VP------LNVQGMLVECRSGDEKRILQE-------------------------DAF 176
            .|....: :|      :|....::.|.:..:|.:..|                         |.:
 Worm   178 MFIKKTLEIPSNERLFVNADAFVINCYNHSKKAVKPEVPIWKKPFPGMKDKNLPEDEILRVKDLY 242

  Fly   177 SFVQY-----QKTSPNLDIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVAD 236
            |:..|     ::.|..:|   :.|:.:.|.|:.:||...|.||.....:....::.:.||.||||
 Worm   243 SYGDYGNKIREQVSKAVD---RYSIDILGFDSTARTMFMRHMPRTVEVMAKLDYHYLYGYTKVAD 304

  Fly   237 NTYPNIFSILTGYSPNSAK------------NQICDTTQPGCLDKIPFIWKDMK-KNGYLTAYAE 288
            |:..|:..||.|....:.|            |.:..|.......|:.|:||.|| |.|..:.:.|
 Worm   305 NSMVNLAPILVGDMEEALKKPKYDKSGDFNINWLLPTEDKMDPTKLNFLWKIMKEKYGCESLFNE 369

  Fly   289 D--TVFSNIFNY----MKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCL-GRRLANSYI 346
            |  |....:|||    .:|||...|.|:|:|....|:.:        ..|...|. |.:|.|.::
 Worm   370 DISTKGLGLFNYPPTEFQPGFTENPADHYYRAYYLAVYE--------NWKYEACRDGEQLQNEFV 426

  Fly   347 FDYCRQFMQRYVADRPI--WGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFS 409
             :..|:|..||   |.|  :||.:...::|:...:|..:..|:...|.....:|..::|:.|...
 Worm   427 -NIWRRFAHRY---RNICHFGFTFVTTLTHEAGLVLEILDEKLAAHLSQMHLNGDLDNTLSIIMG 487

  Fly   410 DHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIIN 474
            |||:|.|.:.......:|||.|:|.:..|..|.|.||...:....|:::|:||||::.||..|::
 Worm   488 DHGNRIGAIKSRYTGRIEERMPLMAMRFPTGFAETYPVEYKNFLDNKHKLTSNFDVHKTLHDIVH 552

  Fly   475 IEGLVEDTKWSYDCPQCQSLFYELPESRSCSEAAIPEAYCTC-----------HNYEEVQEDHGT 528
            :.  :.|.|...|..:..|||..:|.:|:|::..:||.:|.|           .|:.:.      
 Worm   553 MR--LGDNKAKSDEGRGISLFDAIPNTRTCADVIVPENFCMCMIDVSSIANPLPNFNKK------ 609

  Fly   529 WRMAELVVDRINQFLQYHNLQNL--CSSLTLKLVNITEVRITESDEHVSLGK----GLR------ 581
             :..:..:|:.|....:...:||  |       |:::.:...::.:.:::..    |||      
 Worm   610 -KPTDQKMDQFNTLKSWLKTENLDDC-------VDVSSLETGQTFQEMAINPLSRFGLRTKNNAS 666

  Fly   582 ----------------HYHTKFQV---HQN---LAEFFATVLYDRKTEELQINVELISRINIYRP 624
                            :.:.:|.|   ::|   |:....|.|:..|:..     :||....|...
 Worm   667 MLELMKERNKKNPELNYINFEFSVSGTYKNGEPLSMLVRTELFVEKSTS-----QLIFEPMIQEM 726

  Fly   625 DASCLDDNIQKLFCIC 640
            .|||   ....:|.:|
 Worm   727 PASC---RFVSIFDVC 739



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49806
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.